Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Acyl-coenzyme A thioesterase 8 (Acot8) Recombinant Protein | Acot8 recombinant protein

Recombinant Mouse Acyl-coenzyme A thioesterase 8 (Acot8)

Gene Names
Acot8; Pte1; PTE-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Acyl-coenzyme A thioesterase 8 (Acot8); Recombinant Mouse Acyl-coenzyme A thioesterase 8 (Acot8); Acot8 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-320, Full length protein
Sequence
MSAPEGLGDAHGDADRGDLSGDLRSVLVTSVLNLEPLDEDLYRGRHYWVPTSQRLFGGQIMGQALVAAAKSVSEDVHVHSLHCYFVRAGDPKVPVLYHVERIRTGASFSVRAVKAVQHGKAIFICQASFQQMQPSPLQHQFSMPSVPPPEDLLDHEALIDQYLRDPNLHKKYRVGLNRVAAQEVPIEIKVVNPPTLTQLQALEPKQMFWVRARGYIGEGDIKMHCCVAAYISDYAFLGTALLPHQSKYKVNFMASLDHSMWFHAPFRADHWMLYECESPWAGGSRGLVHGRLWRRDGVLAVTCAQEGVIRLKPQVSESKL
Sequence Length
320
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Acot8 recombinant protein
This protein is a peroxisomal thioesterase that appears to be involved more in the oxidation of fatty acids rather than in their formation. The encoded protein can bind to the human immunodeficiency virus-1 protein Nef, and mediate Nef-induced down-regulation of CD4 in T-cells. Multiple transcript variants encoding several different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,827 Da
NCBI Official Full Name
acyl-coenzyme A thioesterase 8
NCBI Official Synonym Full Names
acyl-CoA thioesterase 8
NCBI Official Symbol
Acot8
NCBI Official Synonym Symbols
Pte1; PTE-2
NCBI Protein Information
acyl-coenzyme A thioesterase 8
UniProt Protein Name
Acyl-coenzyme A thioesterase 8
UniProt Gene Name
Acot8
UniProt Synonym Gene Names
Pte1; Pte2; Acyl-CoA thioesterase 8; PTE-2; PTE-1

Uniprot Description

Acyl-coenzyme A (acyl-CoA) thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH (PubMed:11673457). Competes with bile acid CoA:amino acid N-acyltransferase (BAAT) for bile acid-CoA substrate (such as chenodeoxycholoyl-CoA) (PubMed:11673457). Shows a preference for medium-length fatty acyl-CoAs (C2 to C20) (PubMed:11673457). Catalyzes the hydrolysis of CoA esters of bile acids, such as choloyl-CoA and chenodeoxycholoyl-CoA (PubMed:11673457). May be involved in the metabolic regulation of peroxisome proliferation ().

Research Articles on Acot8

Similar Products

Product Notes

The Acot8 acot8 (Catalog #AAA958154) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-320, Full length protein. The amino acid sequence is listed below: MSAPEGLGDA HGDADRGDLS GDLRSVLVTS VLNLEPLDED LYRGRHYWVP TSQRLFGGQI MGQALVAAAK SVSEDVHVHS LHCYFVRAGD PKVPVLYHVE RIRTGASFSV RAVKAVQHGK AIFICQASFQ QMQPSPLQHQ FSMPSVPPPE DLLDHEALID QYLRDPNLHK KYRVGLNRVA AQEVPIEIKV VNPPTLTQLQ ALEPKQMFWV RARGYIGEGD IKMHCCVAAY ISDYAFLGTA LLPHQSKYKV NFMASLDHSM WFHAPFRADH WMLYECESPW AGGSRGLVHG RLWRRDGVLA VTCAQEGVIR LKPQVSESKL. It is sometimes possible for the material contained within the vial of "Acyl-coenzyme A thioesterase 8 (Acot8), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.