SDS-PAGE
Alpha/beta hydrolase domain-containing protein 11 Recombinant Protein | Abhd11 recombinant protein
Recombinant Mouse Alpha/beta hydrolase domain-containing protein 11
Gene Names
Abhd11; Wbscr21; 1110054D16Rik; A630008N09Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Alpha/beta hydrolase domain-containing protein 11; Recombinant Mouse Alpha/beta hydrolase domain-containing protein 11; Williams-Beuren syndrome chromosomal region 21 protein homolog; Abhd11 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-307aa; Full Length
Sequence
MLRWARAWRVPRGVLGASSPRRLAVPVTFCSSRSSGQENADLRPLPLSYNLLDGDATLPAIVFLHGLFGSKTNFNSLAKAMVQRTGRRVLTVDARNHGDSPHSPDASYEAMSQDLQGLLPQLGLVPCVLVGHSMGGKTAMLLALQRPDVVERLVVVDISPVGTTPGSHIGAFIAAMKAVEIPEKVPHSQARKLADKQLSSVVKEAGIRQFLLTNLVEVGGRFSWRLNLDTLAQHLDKIMTFPQQREPYSGPTLFLLGGNSTYVQPSHHSEIRRLFPQAQIQTVPNAGHWVHSDKPQDFMDAVTSFLA
Sequence Length
307
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
References
Identification of additional transcripts in the Williams-Beuren syndrome critical region.Merla G., Ucla C., Guipponi M., Reymond A.Hum. Genet. 110:429-438(2002)
Effects of rosiglitazone and high fat diet on lipase/esterase expression in adipose tissue.Shen W.-J., Patel S., Yu Z., Jue D., Kraemer F.B.Biochim. Biophys. Acta 1771:177-184(2007)
SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35.6 kDa
NCBI Official Full Name
alpha/beta hydrolase domain-containing protein 11 isoform 1
NCBI Official Synonym Full Names
abhydrolase domain containing 11
NCBI Official Symbol
Abhd11
NCBI Official Synonym Symbols
Wbscr21; 1110054D16Rik; A630008N09Rik
NCBI Protein Information
alpha/beta hydrolase domain-containing protein 11
UniProt Protein Name
Protein ABHD11
Protein Family
UniProt Gene Name
Abhd11
UniProt Synonym Gene Names
Abhydrolase domain-containing protein 11
UniProt Entry Name
ABHDB_MOUSE
Uniprot Description
ABHD11: ABHD11 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Belongs to the AB hydrolase superfamily. 5 isoforms of the human protein are produced by alternative splicing.
Protein type: EC 3.-.-.-; Hydrolase
Cellular Component: mitochondrion
Molecular Function: catalytic activity; GPI-anchor transamidase activity; hydrolase activity
Research Articles on Abhd11
Similar Products
Product Notes
The Abhd11 abhd11 (Catalog #AAA1428049) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-307aa; Full Length. The amino acid sequence is listed below: MLRWARAWRV PRGVLGASSP RRLAVPVTFC SSRSSGQENA DLRPLPLSYN LLDGDATLPA IVFLHGLFGS KTNFNSLAKA MVQRTGRRVL TVDARNHGDS PHSPDASYEA MSQDLQGLLP QLGLVPCVLV GHSMGGKTAM LLALQRPDVV ERLVVVDISP VGTTPGSHIG AFIAAMKAVE IPEKVPHSQA RKLADKQLSS VVKEAGIRQF LLTNLVEVGG RFSWRLNLDT LAQHLDKIMT FPQQREPYSG PTLFLLGGNS TYVQPSHHSE IRRLFPQAQI QTVPNAGHWV HSDKPQDFMD AVTSFLA. It is sometimes possible for the material contained within the vial of "Alpha/beta hydrolase domain-containing protein 11, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
