Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ATP-binding cassette sub-family G member 3 (Abcg3) Recombinant Protein | Abcg3 recombinant protein

Recombinant Mouse ATP-binding cassette sub-family G member 3 (Abcg3)

Gene Names
Abcg3; Mxr2; Abcp2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP-binding cassette sub-family G member 3 (Abcg3); Recombinant Mouse ATP-binding cassette sub-family G member 3 (Abcg3); Abcg3 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-650aa; full length protein
Sequence
MASNNDPTVISMIERHLCDLPETNTSDLKTLTEEAVLSFHNISYQETVQSGFPLRKKAYV IERLSNISGIMKPGLNAIMGPQDGSRSLLLDVLAARRDPRGLSGDILINGKPRPANFKCT SGYVPQNDVVLGTVTVRDNLEFSAALRLPVTITRDEKRRRINEVLELLHLNKEQNIKPRS KELRKRTSIAMELVTEHPILFLDDPTTGLDLRTTTDVILVLRRMSKKGRTIIFSINQPQY SIFKFFDSLTLVASGKVMFHGPAQDALEYFRSAGYNYESHNNPADFFLDVINGGFSNILD TEEDGHEDDKYEELFERQYQVTGKLANMYAQSPLYSETRAILDQLLGEQKLERSSAVETT CVTPFCHQLKWIICQSFKNFKGFPWVTVIQAIITVILATAVGTAFRVLKNDCIEVQMRAG LLYLLTIFQCITSVSAGELFVIDRVRFLHEHTSGYYRVSSYFFGKLLAELIPRRLLPSTV FSLITYVIAGVKMSMKCFFTMICTIMVLAYSASSLPLSIGAGENAVAVPTLLVTIYFVFM LFFSGLSLYSGSFLPKLSWIQYFSIPHYGFRALLHNEFLGQNFCPEHNTEEVSRCHNYVI CTGEEFLMIQGIDLSSWGFWENHLALVCTMIILLTITYVQLLQVKNIRNF
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Abcg3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73,613 Da
NCBI Official Full Name
ATP-binding cassette sub-family G member 3
NCBI Official Synonym Full Names
ATP-binding cassette, sub-family G (WHITE), member 3
NCBI Official Symbol
Abcg3
NCBI Official Synonym Symbols
Mxr2; Abcp2
NCBI Protein Information
ATP-binding cassette sub-family G member 3
UniProt Protein Name
ATP-binding cassette sub-family G member 3
Protein Family
UniProt Gene Name
Abcg3
UniProt Entry Name
ABCG3_MOUSE

NCBI Description

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. It lacks several highly conserved residues found in other ATP-binding proteins; this suggests that this protein may not bind ATP and may require dimerization with another subunit to form a functional ATP-transporter. The function of this gene has not yet been determined; however, high levels of expression in the thymus and spleen suggest a potential role in the transport of specific peptides or hydrophobic compounds from lymphocytes. [provided by RefSeq, Jul 2008]

Uniprot Description

ABCG3: is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. It lacks several highly conserved residues found in other ATP-binding proteins; this suggests that this protein may not bind ATP and may require dimerization with another subunit to form a functional ATP-transporter. The function of this gene has not yet been determined; however, high levels of expression in the thymus and spleen suggest a potential role in the transport of specific peptides or hydrophobic compounds from lymphocytes. [provided by RefSeq, Jul 2008]

Protein type: Membrane protein, integral; Transporter

Cellular Component: integral to membrane; membrane; plasma membrane

Molecular Function: ATP binding; ATPase activity; ATPase activity, coupled to transmembrane movement of substances; drug transporter activity

Biological Process: multidrug transport; transport

Similar Products

Product Notes

The Abcg3 abcg3 (Catalog #AAA7007160) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-650aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Abcg3 abcg3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MASNNDPTVI SMIERHLCDL PETNTSDLKT LTEEAVLSFH NISYQETVQS GFPLRKKAYV IERLSNISGI MKPGLNAIMG PQDGSRSLLL DVLAARRDPR GLSGDILING KPRPANFKCT SGYVPQNDVV LGTVTVRDNL EFSAALRLPV TITRDEKRRR INEVLELLHL NKEQNIKPRS KELRKRTSIA MELVTEHPIL FLDDPTTGLD LRTTTDVILV LRRMSKKGRT IIFSINQPQY SIFKFFDSLT LVASGKVMFH GPAQDALEYF RSAGYNYESH NNPADFFLDV INGGFSNILD TEEDGHEDDK YEELFERQYQ VTGKLANMYA QSPLYSETRA ILDQLLGEQK LERSSAVETT CVTPFCHQLK WIICQSFKNF KGFPWVTVIQ AIITVILATA VGTAFRVLKN DCIEVQMRAG LLYLLTIFQC ITSVSAGELF VIDRVRFLHE HTSGYYRVSS YFFGKLLAEL IPRRLLPSTV FSLITYVIAG VKMSMKCFFT MICTIMVLAY SASSLPLSIG AGENAVAVPT LLVTIYFVFM LFFSGLSLYS GSFLPKLSWI QYFSIPHYGF RALLHNEFLG QNFCPEHNTE EVSRCHNYVI CTGEEFLMIQ GIDLSSWGFW ENHLALVCTM IILLTITYVQ LLQVKNIRNF. It is sometimes possible for the material contained within the vial of "ATP-binding cassette sub-family G member 3 (Abcg3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.