Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: NFKBIESample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Rabbit NFKBIE Polyclonal Antibody | anti-NFKBIE antibody

NFKBIE antibody - middle region

Gene Names
NFKBIE; IKBE
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NFKBIE; Polyclonal Antibody; NFKBIE antibody - middle region; anti-NFKBIE antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DARMLNGCTPLHLAAGRGLMGISSTLCKAGADSLLRNVEDETPQDLTEES
Sequence Length
500
Applicable Applications for anti-NFKBIE antibody
Western Blot (WB)
Homology
Cow: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 93%; Rabbit: 93%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NFKBIE
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: NFKBIESample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: NFKBIESample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-NFKBIE Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HT1080 cell lysate)

Western Blot (WB) (WB Suggested Anti-NFKBIE Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HT1080 cell lysate)
Related Product Information for anti-NFKBIE antibody
This is a rabbit polyclonal antibody against NFKBIE. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008 or NFKBIB, MIM 604495), which inactivate NF-ka
Product Categories/Family for anti-NFKBIE antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
NF-kappa-B inhibitor epsilon
NCBI Official Synonym Full Names
NFKB inhibitor epsilon
NCBI Official Symbol
NFKBIE
NCBI Official Synonym Symbols
IKBE
NCBI Protein Information
NF-kappa-B inhibitor epsilon
UniProt Protein Name
NF-kappa-B inhibitor epsilon
Protein Family
UniProt Gene Name
NFKBIE
UniProt Synonym Gene Names
IKBE; NF-kappa-BIE; IkB-E; IkB-epsilon
UniProt Entry Name
IKBE_HUMAN

NCBI Description

The protein encoded by this gene binds to components of NF-kappa-B, trapping the complex in the cytoplasm and preventing it from activating genes in the nucleus. Phosphorylation of the encoded protein targets it for destruction by the ubiquitin pathway, which activates NF-kappa-B by making it available to translocate to the nucleus. [provided by RefSeq, Sep 2011]

Uniprot Description

IkB-epsilon: Inhibits NF-kappa-B by complexing with and trapping it in the cytoplasm. Inhibits DNA-binding of NF-kappa-B p50-p65 and p50-c-Rel complexes. Interacts with RELA, REL, NFKB1 nuclear factor NF-kappa-B p50 subunit and NFKB2 nuclear factor NF-kappa-B p52 subunit. Highly expressed in spleen, testis and lung, followed by kidney, pancreas, heart, placenta and brain. Also expressed in granulocytes and macrophages. Belongs to the NF-kappa-B inhibitor family.

Protein type: Inhibitor; DNA-binding

Chromosomal Location of Human Ortholog: 6p21.1

Cellular Component: Golgi apparatus; perinuclear region of cytoplasm; cytoplasm; cytosol

Molecular Function: protein binding

Biological Process: cytoplasmic sequestering of transcription factor; D-serine transport

Research Articles on NFKBIE

Similar Products

Product Notes

The NFKBIE nfkbie (Catalog #AAA3204109) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NFKBIE antibody - middle region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NFKBIE can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NFKBIE nfkbie for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DARMLNGCTP LHLAAGRGLM GISSTLCKAG ADSLLRNVED ETPQDLTEES. It is sometimes possible for the material contained within the vial of "NFKBIE, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.