Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ABC transporter B family member 23 (ABCB23) Recombinant Protein | ABCB23 recombinant protein

Recombinant Arabidopsis thaliana ABC transporter B family member 23, mitochondrial (ABCB23)

Gene Names
ATM1; ABC transporter of the mitochondrion 1; ATATM1; ATM1; HALF-MOLECULE ABC TRANSPORTER ATM1; T5F17.80; T5F17_80
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ABC transporter B family member 23 (ABCB23); Recombinant Arabidopsis thaliana ABC transporter B family member 23; mitochondrial (ABCB23); ABCB23 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
71-678aa; full length protein
Sequence
NQDQTKTASSKKILRTISSYLWMKDNPELRFRVIAALACLIGAKFLNVQVPFLFKLSIDL LSSYSSSTITDSNPYLLAAFATPSSVLIGYGIARSGSSAFNELRTAVFSKVSLRTIRSVS RKVLSHLHDLDLRYHLNRETGALNRIIDRGSRAINTILSAMVFNVVPTILEISMVTGILA YNFGPVFALITSLSVGSYIAFTLVVTQYRTKFRKAMNQADNDASTRAIDSLVNYETVKYF NNEDYEARKYDDLLGRYEDAALQTQKSLAFLDFGQSFIFSTALSTSMVLCSQGIMNGEMT VGDLVMVNGLLFQLSLPLYFLGGVYRETVQGLVDMKSLFQLLEERSDIGDKDTETKLPPL VLRGGSISFENVHFSYLPERKILDGISFEVPAGKSVAIVGSSGSGKSTILRMIFRFFDTD SGNVRIDGQDIKEVTLESLRSCIGVVPQDTVLFNDTIFHNIHYGNLSATEEEVYDAARRA VIHDTIMKFPDKYSTAVGERGLMLSGGEKQRVALARAFLKSPAILLCDEATNALDSKTEA EIMKTFRSLASNRTCIFIAHRLTTAMQCDEIIVMEKGKVVEKGTHQVLLEKSGRYAKLWT QQNSTLEV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for ABCB23 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75,469 Da
NCBI Official Full Name
ABC transporter B family member 23
NCBI Official Symbol
ATM1
NCBI Official Synonym Symbols
ABC transporter of the mitochondrion 1; ATATM1; ATM1; HALF-MOLECULE ABC TRANSPORTER ATM1; T5F17.80; T5F17_80
NCBI Protein Information
ABC transporter B family member 23
UniProt Protein Name
ABC transporter B family member 23, mitochondrial
Protein Family
UniProt Gene Name
ABCB23
UniProt Synonym Gene Names
ATM1; STA2; ABC transporter ABCB.23; AtABCB23; AtATM1; Iron-sulfur clusters transporter ATM1
UniProt Entry Name
AB23B_ARATH

NCBI Description

Half-molecule ABC transporter ATM1. Arabidopsis thaliana has three ATM genes, namely ATM1, ATM2 and ATM3. Only ATM3 has an important function for plant growth.

Uniprot Description

Performs an essential function in the generation of cytoplasmic iron-sulfur proteins by mediating export of Fe/S cluster precursors synthesized by NFS1 and other mitochondrial proteins. Not involved in the export of cyclic pyranopterin monophosphate (cPMP) from mitochondria into the cytosol.

Research Articles on ABCB23

Similar Products

Product Notes

The ABCB23 abcb23 (Catalog #AAA7007099) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 71-678aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the ABCB23 abcb23 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NQDQTKTASS KKILRTISSY LWMKDNPELR FRVIAALACL IGAKFLNVQV PFLFKLSIDL LSSYSSSTIT DSNPYLLAAF ATPSSVLIGY GIARSGSSAF NELRTAVFSK VSLRTIRSVS RKVLSHLHDL DLRYHLNRET GALNRIIDRG SRAINTILSA MVFNVVPTIL EISMVTGILA YNFGPVFALI TSLSVGSYIA FTLVVTQYRT KFRKAMNQAD NDASTRAIDS LVNYETVKYF NNEDYEARKY DDLLGRYEDA ALQTQKSLAF LDFGQSFIFS TALSTSMVLC SQGIMNGEMT VGDLVMVNGL LFQLSLPLYF LGGVYRETVQ GLVDMKSLFQ LLEERSDIGD KDTETKLPPL VLRGGSISFE NVHFSYLPER KILDGISFEV PAGKSVAIVG SSGSGKSTIL RMIFRFFDTD SGNVRIDGQD IKEVTLESLR SCIGVVPQDT VLFNDTIFHN IHYGNLSATE EEVYDAARRA VIHDTIMKFP DKYSTAVGER GLMLSGGEKQ RVALARAFLK SPAILLCDEA TNALDSKTEA EIMKTFRSLA SNRTCIFIAH RLTTAMQCDE IIVMEKGKVV EKGTHQVLLE KSGRYAKLWT QQNSTLEV. It is sometimes possible for the material contained within the vial of "ABC transporter B family member 23 (ABCB23), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.