Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ATP-binding cassette sub-family B member 10 (ABCB10) Recombinant Protein | ABCB10 recombinant protein

Recombinant Human ATP-binding cassette sub-family B member 10, mitochondrial (ABCB10)

Gene Names
ABCB10; M-ABC2; MTABC2; EST20237
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP-binding cassette sub-family B member 10 (ABCB10); Recombinant Human ATP-binding cassette sub-family B member 10; mitochondrial (ABCB10); ABCB10 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
106-738aa; full length protein
Sequence
AGPGAPRLPRARFPGGPAAAAWAGDEAWRRGPAAPPGDKGRLRPAAAGLPEARKLLGLAY PERRRLAAAVGFLTMSSVISMSAPFFLGKIIDVIYTNPTVDYSDNLTRLCLGLSAVFLCG AAANAIRVYLMQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRS VTENLSDGLRAGAQASVGISMMFFVSPNLATFVLSVVPPVSIIAVIYGRYLRKLTKVTQD SLAQATQLAEERIGNVRTVRAFGKEMTEIEKYASKVDHVMQLARKEAFARAGFFGATGLS GNLIVLSVLYKGGLLMGSAHMTVGELSSFLMYAFWVGISIGGLSSFYSELMKGLGAGGRL WELLEREPKLPFNEGVILNEKSFQGALEFKNVHFAYPARPEVPIFQDFSLSIPSGSVTAL VGPSGSGKSTVLSLLLRLYDPASGTISLDGHDIRQLNPVWLRSKIGTVSQEPILFSCSIA ENIAYGADDPSSVTAEEIQRVAEVANAVAFIRNFPQGFNTVVGEKGVLLSGGQKQRIAIA RALLKNPKILLLDEATSALDAENEYLVQEALDRLMDGRTVLVIAHRLSTIKNANMVAVLD QGKITEYGKHEELLSKPNGIYRKLMNKQSFISA
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for ABCB10 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
79,148 Da
NCBI Official Full Name
ATP-binding cassette sub-family B member 10, mitochondrial
NCBI Official Synonym Full Names
ATP binding cassette subfamily B member 10
NCBI Official Symbol
ABCB10
NCBI Official Synonym Symbols
M-ABC2; MTABC2; EST20237
NCBI Protein Information
ATP-binding cassette sub-family B member 10, mitochondrial
UniProt Protein Name
ATP-binding cassette sub-family B member 10, mitochondrial
Protein Family
UniProt Gene Name
ABCB10
UniProt Synonym Gene Names
ABC transporter 10 protein; M-ABC2
UniProt Entry Name
ABCBA_HUMAN

NCBI Description

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown. [provided by RefSeq, Jul 2008]

Uniprot Description

ABCB10: May mediate critical mitochondrial transport functions related to heme biosynthesis. Belongs to the ABC transporter superfamily. ABCB family. Mitochondrial peptide exporter (TC 3.A.1.212) subfamily.

Protein type: Hydrolase; Membrane protein, multi-pass; Membrane protein, integral; Transporter, ABC family; Transporter; Mitochondrial

Chromosomal Location of Human Ortholog: 1q42.13

Cellular Component: mitochondrial inner membrane

Molecular Function: ATP binding; ATPase activity, coupled to transmembrane movement of substances; protein homodimerization activity; transporter activity

Biological Process: metabolic process; transmembrane transport; transport

Research Articles on ABCB10

Similar Products

Product Notes

The ABCB10 abcb10 (Catalog #AAA7007097) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 106-738aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the ABCB10 abcb10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AGPGAPRLPR ARFPGGPAAA AWAGDEAWRR GPAAPPGDKG RLRPAAAGLP EARKLLGLAY PERRRLAAAV GFLTMSSVIS MSAPFFLGKI IDVIYTNPTV DYSDNLTRLC LGLSAVFLCG AAANAIRVYL MQTSGQRIVN RLRTSLFSSI LRQEVAFFDK TRTGELINRL SSDTALLGRS VTENLSDGLR AGAQASVGIS MMFFVSPNLA TFVLSVVPPV SIIAVIYGRY LRKLTKVTQD SLAQATQLAE ERIGNVRTVR AFGKEMTEIE KYASKVDHVM QLARKEAFAR AGFFGATGLS GNLIVLSVLY KGGLLMGSAH MTVGELSSFL MYAFWVGISI GGLSSFYSEL MKGLGAGGRL WELLEREPKL PFNEGVILNE KSFQGALEFK NVHFAYPARP EVPIFQDFSL SIPSGSVTAL VGPSGSGKST VLSLLLRLYD PASGTISLDG HDIRQLNPVW LRSKIGTVSQ EPILFSCSIA ENIAYGADDP SSVTAEEIQR VAEVANAVAF IRNFPQGFNT VVGEKGVLLS GGQKQRIAIA RALLKNPKIL LLDEATSALD AENEYLVQEA LDRLMDGRTV LVIAHRLSTI KNANMVAVLD QGKITEYGKH EELLSKPNGI YRKLMNKQSF ISA. It is sometimes possible for the material contained within the vial of "ATP-binding cassette sub-family B member 10 (ABCB10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.