Tubulin beta-2A chain Recombinant Protein | TUBB2A recombinant protein

Recombinant Human Tubulin beta-2A chain

Cat. Num. AAA969627

• Gene Names: TUBB2A; TUBB; TUBB2; CDCBM5
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Tubulin beta-2A chain; Recombinant Human Tubulin beta-2A chain; Tubulin beta class IIa; TUBB2A recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-445aa; Full Length
• Sequence: MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for TUBB2A recombinant protein

Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.

Product Categories/Family for TUBB2A recombinant protein

Signal Transduction

References

Cloning and vaccinia virus expression of a cDNA containing the complete coding sequence of human beta tubulin mRNA.Leffers H., Wiemann S., Ansorge W. Class II beta tubulin sequence from MCF7 breast cancer cells.Banerjee A. De novo mutations in the beta-tubulin gene TUBB2A cause simplified gyral patterning and infantile-onset epilepsy.Cushion T.D., Paciorkowski A.R., Pilz D.T., Mullins J.G., Seltzer L.E., Marion R.W., Tuttle E., Ghoneim D., Christian S.L., Chung S.K., Rees M.I., Dobyns W.B.Am. J. Hum. Genet. 94:634-641(2014)

NCBI and Uniprot Product Information

• NCBI GI #: 4507729
• NCBI GeneID: 7280
• NCBI Accession #: NP_001060.1
• NCBI GenBank Nucleotide #: NM_001069.2
• UniProt Accession #: Q13885; Q6FGZ8; Q8IWR2
• Molecular Weight: 51.9 kDa
• NCBI Official Full Name: tubulin beta-2A chain isoform 1
• NCBI Official Synonym Full Names: tubulin beta 2A class IIa
• NCBI Official Symbol: TUBB2A
• NCBI Official Synonym Symbols: TUBB; TUBB2; CDCBM5
• NCBI Protein Information: tubulin beta-2A chain
• UniProt Protein Name: Tubulin beta-2A chain
• Protein Family: Tubulin
• UniProt Gene Name: TUBB2A
• UniProt Synonym Gene Names: TUBB2
• UniProt Entry Name: TBB2A_HUMAN

NCBI Description

Microtubules, key participants in processes such as mitosis and intracellular transport, are composed of heterodimers of alpha- and beta-tubulins. The protein encoded by this gene is a beta-tubulin. Defects in this gene are associated with complex cortical dysplasia with other brain malformations-5. Two transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2015]

Uniprot Description

TUBB2A: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain. Belongs to the tubulin family.

Protein type: Cytoskeletal; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 6p25

Cellular Component: cytoplasm; microtubule; nucleus

Molecular Function: GTP binding; GTPase activity; protein binding; structural constituent of cytoskeleton

Biological Process: 'de novo' posttranslational protein folding; cellular protein metabolic process; microtubule-based process; protein folding

Disease: Cortical Dysplasia, Complex, With Other Brain Malformations 5