Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Muellerian-inhibiting factor (Amh) Recombinant Protein | Amh recombinant protein

Recombinant Mouse Muellerian-inhibiting factor (Amh), partial

Gene Names
Amh; MIS
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Muellerian-inhibiting factor (Amh); Recombinant Mouse Muellerian-inhibiting factor (Amh); partial; Anti-Muellerian hormone; AMH; Muellerian-inhibiting substance; MIS; Amh recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
450-552. Partial
Sequence
DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC
Production Note
Special Offer: The E Coli, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Coli, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

SDS-Page
Related Product Information for Amh recombinant protein
This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin.
References
Expression of the mouse anti-Mullerian hormone gene suggests a role in both male and female sexual differentiation.Muensterberg A., Lovell-Badge R.Development 113:613-624(1991) A GNRP-like gene shares a bidirectional promoter with SAP62 immediately upstream of AMH.Dresser D.W., Jamin S., Atkins C.J., Guerrier D. The genes for a spliceosome protein (SAP62) and the anti-Mullerian hormone (AMH) are contiguous.Dresser D.W., Hacker A., Lovell-Badge R., Guerrier D.Hum. Mol. Genet. 4:1613-1618(1995)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
11.3 kDa
NCBI Official Full Name
Muellerian-inhibiting factor
NCBI Official Synonym Full Names
anti-Mullerian hormone
NCBI Official Symbol
Amh
NCBI Official Synonym Symbols
MIS
NCBI Protein Information
muellerian-inhibiting factor
UniProt Protein Name
Muellerian-inhibiting factor
UniProt Gene Name
Amh
UniProt Synonym Gene Names
AMH; MIS
UniProt Entry Name
MIS_MOUSE

NCBI Description

This gene is a member of the transforming growth factor-beta superfamily of growth and differentiation factors. The encoded protein is produced in fetal Sertoli cells during male gonadal differentiation. The protein binds to the anti-Mullerian hormone receptor type 2 and causes the regression of Mullerian ducts in developing male embryos. In humans, some mutations in this gene are associated with persistent Mullerian duct syndrome (PMDS). [provided by RefSeq, Apr 2013]

Uniprot Description

AMH: This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin. Defects in AMH are the cause of persistent Muellerian duct syndrome type 1 (PMDS1). PMDS1 is a form of male pseudohermaphroditism characterized by a failure of Muellerian duct regression in otherwise normal males. Belongs to the TGF-beta family.

Protein type: Secreted, signal peptide; Secreted

Cellular Component: cytoplasm; extracellular space

Molecular Function: hormone activity; receptor binding; transforming growth factor beta receptor binding

Biological Process: activation of NF-kappaB transcription factor; cell-cell signaling; Mullerian duct regression; preantral ovarian follicle growth; urogenital system development

Research Articles on Amh

Similar Products

Product Notes

The Amh amh (Catalog #AAA968365) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 450-552. Partial. The amino acid sequence is listed below: DKGQDGPCAL RELSVDLRAE RSVLIPETYQ ANNCQGACRW PQSDRNPRYG NHVVLLLKMQ ARGAALGRLP CCVPTAYAGK LLISLSEERI SADHVPNMVA TEC. It is sometimes possible for the material contained within the vial of "Muellerian-inhibiting factor (Amh), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.