Calcium-dependent phospholipase A2 Recombinant Protein | Pla2g5 recombinant protein

Recombinant Mouse Calcium-dependent phospholipase A2

Cat. Num. AAA968147

• Gene Names: Pla2g5; PLA2; sPLA2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Calcium-dependent phospholipase A2; Recombinant Mouse Calcium-dependent phospholipase A2; Group V phospholipase A2; PLA2-10; Phosphatidylcholine 2-acylhydrolase 5; Pla2g5 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 21-137aa; Full Length of Mature Protein
• Sequence: GLLELKSMIEKVTGKNAFKNYGFYGCYCGWGGRGTPKDGTDWCCQMHDRCYGQLEEKDCAIRTQSYDYRYTNGLVICEHDSFCPMRLCACDRKLVYCLRRNLWTYNPLYQYYPNFLC
• Sequence Length: 137

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for Pla2g5 recombinant protein

PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes L-alpha-palmitoyl-2-oleoyl phosphatidylcholine more efficiently than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol.

References

Low-molecular-weight, calcium-dependent phospholipase A2 genes are linked and map to homologous chromosome regions in mouse and human.Tischfield J.A., Xia Y.R., Shih D.M., Klisak I., Chen J., Engle S.J., Siakotos A.N., Winstead M.V., Seilhamer J.J., Allamand V., Gyapay G., Lusis A.Genomics 32:328-333(1996) Low molecular weight group IIA and group V phospholipase A(2) enzymes have different intracellular locations in mouse bone marrow-derived mast cells.Bingham C.O. III, Fijneman R.J.A., Friend D.S., Goddeau R.P., Rogers R.A., Austen K.F., Arm J.P.J. Biol. Chem. 274:31476-31484(1999)

NCBI and Uniprot Product Information

• NCBI GI #: 171906563
• NCBI GeneID: 18784
• NCBI Accession #: NP_001116426.1
• NCBI GenBank Nucleotide #: NM_001122954.1
• UniProt Accession #: P97391; Q9QZU6
• Molecular Weight: 29.8 kDa
• NCBI Official Full Name: calcium-dependent phospholipase A2
• NCBI Official Synonym Full Names: phospholipase A2, group V
• NCBI Official Symbol: Pla2g5
• NCBI Official Synonym Symbols: PLA2; sPLA2
• NCBI Protein Information: calcium-dependent phospholipase A2
• UniProt Protein Name: Calcium-dependent phospholipase A2
• Protein Family: Calcium-dependent phospholipase
• UniProt Gene Name: Pla2g5
• UniProt Entry Name: PA2G5_MOUSE

Uniprot Description

PLA2G5: PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes more efficiently L-alpha-1-palmitoyl-2-oleoyl phosphatidylcholine than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L- alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine, or L- alpha-1-stearoyl-2-arachidonyl phosphatidylinositol. May be involved in the production of lung surfactant, the remodeling or regulation of cardiac muscle. Defects in PLA2G5 are the cause of fleck retina, familial benign (FRFB). An autosomal recessive condition associated with a distinctive retinal appearance and no apparent visual or electrophysiologic deficits. Affected individuals are asymptomatic, but fundus examination reveals a striking pattern of diffuse, yellow-white, fleck-like lesions extending to the far periphery of the retina but sparing the foveal region. Belongs to the phospholipase A2 family.

Protein type: Secreted, signal peptide; Secreted; Phospholipase; Lipid Metabolism - alpha-linolenic acid; Lipid Metabolism - arachidonic acid; Lipid Metabolism - linoleic acid; Lipid Metabolism - glycerophospholipid; EC 3.1.1.4; Lipid Metabolism - ether lipid; Cell surface

Cellular Component: cell surface; extracellular region; Golgi apparatus; membrane; perinuclear region of cytoplasm; plasma membrane

Molecular Function: calcium ion binding; calcium-dependent phospholipase A2 activity; heparin binding; hydrolase activity; metal ion binding; phospholipase A2 activity; receptor binding

Biological Process: arachidonic acid secretion; leukotriene biosynthetic process; lipid catabolic process; lipid metabolic process; phospholipid metabolic process; platelet activating factor biosynthetic process