Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CD9 antigen (CD9) Recombinant Protein | CD9 recombinant protein

Recombinant Human CD9 antigen (CD9)

Gene Names
CD9; MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN29; TSPAN-29
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CD9 antigen (CD9); Recombinant Human CD9 antigen (CD9); Recombinant CD9 antigen (CD9); CD9 antigen; 5H9 antigen Cell growth-inhibiting gene 2 protein Leukocyte antigen MIC3 Motility-related protein; MRP-1 Tetraspanin-29; Tspan-29 p24 CD_antigen= CD9; CD9 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
111-228, Fragment at the C-terminal include a complete extracellular domain and intracellular domain.
Sequence
YSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
Sequence Length
228
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
928
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,416 Da
NCBI Official Full Name
CD9 antigen
NCBI Official Synonym Full Names
CD9 molecule
NCBI Official Symbol
CD9
NCBI Official Synonym Symbols
MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN29; TSPAN-29
NCBI Protein Information
CD9 antigen; 5H9 antigen; tetraspanin-29; BA-2/p24 antigen; CD9 antigen (p24); leukocyte antigen MIC3; motility related protein-1; cell growth-inhibiting gene 2 protein
UniProt Protein Name
CD9 antigen
Protein Family
UniProt Gene Name
CD9
UniProt Synonym Gene Names
MIC3; TSPAN29; MRP-1; Tspan-29
UniProt Entry Name
CD9_HUMAN

NCBI Description

This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis. [provided by RefSeq, Jan 2011]

Uniprot Description

CD9: Involved in platelet activation and aggregation. Regulates paranodal junction formation. Involved in cell adhesion, cell motility and tumor metastasis. Required for sperm-egg fusion. Belongs to the tetraspanin (TM4SF) family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Motility/polarity/chemotaxis; Cell adhesion

Chromosomal Location of Human Ortholog: 12p13.3

Cellular Component: extracellular space; platelet alpha granule membrane; focal adhesion; integral to plasma membrane; apical plasma membrane; plasma membrane; vesicle; external side of plasma membrane

Molecular Function: integrin binding; protein binding

Biological Process: platelet activation; negative regulation of cell proliferation; platelet degranulation; fusion of sperm to egg plasma membrane; single fertilization; pathogenesis; brain development; cell motility; oligodendrocyte development; blood coagulation; cell adhesion; response to water deprivation; multicellular organism reproduction; paranodal junction assembly

Research Articles on CD9

Similar Products

Product Notes

The CD9 cd9 (Catalog #AAA967249) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 111-228, Fragment at the C-terminal include a complete extracellular domain and intracellular domain. The amino acid sequence is listed below: YSHKDEVIKE VQEFYKDTYN KLKTKDEPQR ETLKAIHYAL NCCGLAGGVE QFISDICPKK DVLETFTVKS CPDAIKEVFD NKFHIIGAVG IGIAVVMIFG MIFSMILCCA IRRNREMV . It is sometimes possible for the material contained within the vial of "CD9 antigen (CD9), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.