Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

3-oxo-5-alpha-steroid 4-dehydrogenase 1 (Srd5a1) Recombinant Protein | Srd5a1 recombinant protein

Recombinant Rat 3-oxo-5-alpha-steroid 4-dehydrogenase 1 (Srd5a1)

Gene Names
Srd5a1; S5AR 1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3-oxo-5-alpha-steroid 4-dehydrogenase 1 (Srd5a1); Recombinant Rat 3-oxo-5-alpha-steroid 4-dehydrogenase 1 (Srd5a1); Recombinant 3-oxo-5-alpha-steroid 4-dehydrogenase 1 (Srd5a1); 3-oxo-5-alpha-steroid 4-dehydrogenase 1 EC= 1.3.99.5; SR type 1 Steroid 5-alpha-reductase 1; S5AR 1; Srd5a1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-259
Sequence
MVPLMELDELCLLDMLVYLEGFMAFVSIVGLRSVGSPYGRYSPQWPGIRVPARPAWFIQELPSMAWPLYEYIRPAAARLGNLPNRVLLAMFLIHYVQRTLVFPVLIRGGKPTLLVTFVLAFLFCTFNGYVQSRYLSQFAVYAEDWVTHPCFLTGFALWLVGMVINIHSDHILRNLRKPGETGYKIPRGGLFEYVSAANYFGELVEWCGFALASWSLQGVVFALFTLSTLLTRAKQHHQWYHEKFEDYPKSRKILIPFVL
Sequence Length
259
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,780 Da
NCBI Official Full Name
3-oxo-5-alpha-steroid 4-dehydrogenase 1
NCBI Official Synonym Full Names
steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)
NCBI Official Symbol
Srd5a1
NCBI Official Synonym Symbols
S5AR 1
NCBI Protein Information
3-oxo-5-alpha-steroid 4-dehydrogenase 1; SR type 1; steroid 5 alpha-reductase 1; steroid 5-alpha-reductase 1; steroid-5-alpha-reductase 1
UniProt Protein Name
3-oxo-5-alpha-steroid 4-dehydrogenase 1
UniProt Gene Name
Srd5a1
UniProt Synonym Gene Names
S5AR 1
UniProt Entry Name
S5A1_RAT

NCBI Description

catalyzes the conversion of testosterone to dihydrotestosterone; required for male sex differentiation [RGD, Feb 2006]

Uniprot Description

Function: Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology.

Catalytic activity: 5-alpha-pregnan-3,20-dione + NADP+ = progesterone + NADPH.

Subcellular location: Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein

Potential.

Tissue specificity: Liver and prostate (at a low level).

Developmental stage: After the establishment of chromosomal sex at fertilization.

Induction: Its expression is regulated by androgens such as testosterone.

Sequence similarities: Belongs to the steroid 5-alpha reductase family.

Biophysicochemical propertiespH dependence:Optimally active at alkaline pHs.

Research Articles on Srd5a1

Similar Products

Product Notes

The Srd5a1 srd5a1 (Catalog #AAA966376) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-259. The amino acid sequence is listed below: MVPLMELDEL CLLDMLVYLE GFMAFVSIVG LRSVGSPYGR YSPQWPGIRV PARPAWFIQE LPSMAWPLYE YIRPAAARLG NLPNRVLLAM FLIHYVQRTL VFPVLIRGGK PTLLVTFVLA FLFCTFNGYV QSRYLSQFAV YAEDWVTHPC FLTGFALWLV GMVINIHSDH ILRNLRKPGE TGYKIPRGGL FEYVSAANYF GELVEWCGFA LASWSLQGVV FALFTLSTLL TRAKQHHQWY HEKFEDYPKS RKILIPFVL. It is sometimes possible for the material contained within the vial of "3-oxo-5-alpha-steroid 4-dehydrogenase 1 (Srd5a1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.