Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Steroidogenic factor 1 (NR5A1) Recombinant Protein | NR5A1 recombinant protein

Recombinant Pig Steroidogenic factor 1 (NR5A1)

Gene Names
NR5A1; SF-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Steroidogenic factor 1 (NR5A1); Recombinant Pig Steroidogenic factor 1 (NR5A1); Recombinant Steroidogenic factor 1 (NR5A1); Steroidogenic factor 1; SF-1; STF-1; Adrenal 4-binding protein Fushi tarazu factor homolog 1 Nuclear receptor subfamily 5 group A member 1 Steroid hormone receptor Ad4BP; NR5A1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-461aa; Full length protein
Sequence
MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKT QRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQIRANGFKL ETGPPMGVAPPPPPPPDYMLPPGLHAPEPKGLAAGPPTGPLGDFGAPTLPMAVPSAHGPL AGYLYPAFPGRAIKSEYPEPYASPPQPGPPYGYPEPFSGGPGVPELIVQLLQLEPDEDQV RARIVGCLQEPAKGRPDQPAPFSLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQN CWSELLVFDHIYRQIQHGKEGSILLVTGQEVELTTVAAQAGSLLHGLVLRAQELVLQLHA LQLDRQEFVCLKFLILFSLDVKFLNNHSLVKDAQEKANAALLDYTLCHYPHCGDKFQQLL LCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT
Sequence Length
461
Species
Sus scrofa (Pig)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for NR5A1 recombinant protein
This protein is a transcriptional activator involved in sex determination. The encoded protein binds DNA as a monomer. Defects in this gene are a cause of XY sex reversal with or without adrenal failure as well as adrenocortical insufficiency without ovarian defect.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,575 Da
NCBI Official Full Name
steroidogenic factor 1
NCBI Official Symbol
NR5A1
NCBI Official Synonym Symbols
SF-1
NCBI Protein Information
steroidogenic factor 1; STF-1; adrenal 4-binding protein; steroidogenic factor-1 SF-1; fushi tarazu factor homolog 1; steroid hormone receptor Ad4BP; nuclear receptor subfamily 5 group A member 1
UniProt Protein Name
Steroidogenic factor 1
Protein Family
UniProt Gene Name
NR5A1
UniProt Synonym Gene Names
FTZF1; SF-1; STF-1
UniProt Entry Name
STF1_PIG

Uniprot Description

Function: Transcriptional activator. Seems to be essential for sexual differentiation and formation of the primary steroidogenic tissues. Binds to the Ad4 site found in the promoter region of steroidogenic P450 genes such as CYP11A, CYP11B and CYP21B. Also regulates the AMH/Muellerian inhibiting substance gene as well as the AHCH and STAR genes. 5'-YCAAGGYC-3' and 5'-RRAGGTCA-3' are the consensus sequences for the recognition by NR5A1. The SFPQ-NONO-NR5A1 complex binds to the CYP17 promoter and regulates basal and cAMP-dependent transcriptional avtivity. Binds phosphatidylcholine and phospholipids with a phosphatidylinositol (PI) headgroup, in particular PI(3,4)P2 and PI(3,4,5)P3. Activated by the phosphorylation of NR5A1 by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation

By similarity.

Subunit structure: Binds DNA as a monomer

By similarity. Part of a complex consisting of SFPQ, NONO and NR5A1. Interacts with NR0B2, NCOA2 and PPARGC1A. Interacts with DGKQ and CDK7. Binds to and activated by HIPK3

By similarity.

Subcellular location: Nucleus

By similarity.

Post-translational modification: Acetylation stimulates the transcriptional activity

By similarity.Sumoylation reduces CDK7-mediated phosophorylation on Ser-203

By similarity.Phosphorylated on Ser-203 by CDK7. This phosphorylation promotes transcriptional activity

By similarity.

Sequence similarities: Belongs to the nuclear hormone receptor family. NR5 subfamily.Contains 1 nuclear receptor DNA-binding domain.

Research Articles on NR5A1

Similar Products

Product Notes

The NR5A1 nr5a1 (Catalog #AAA964869) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-461aa; Full length protein. The amino acid sequence is listed below: MDYSYDEDLD ELCPVCGDKV SGYHYGLLTC ESCKGFFKRT VQNNKHYTCT ESQSCKIDKT QRKRCPFCRF QKCLTVGMRL EAVRADRMRG GRNKFGPMYK RDRALKQQKK AQIRANGFKL ETGPPMGVAP PPPPPPDYML PPGLHAPEPK GLAAGPPTGP LGDFGAPTLP MAVPSAHGPL AGYLYPAFPG RAIKSEYPEP YASPPQPGPP YGYPEPFSGG PGVPELIVQL LQLEPDEDQV RARIVGCLQE PAKGRPDQPA PFSLLCRMAD QTFISIVDWA RRCMVFKELE VADQMTLLQN CWSELLVFDH IYRQIQHGKE GSILLVTGQE VELTTVAAQA GSLLHGLVLR AQELVLQLHA LQLDRQEFVC LKFLILFSLD VKFLNNHSLV KDAQEKANAA LLDYTLCHYP HCGDKFQQLL LCLVEVRALS MQAKEYLYHK HLGNEMPRNN LLIEMLQAKQ T. It is sometimes possible for the material contained within the vial of "Steroidogenic factor 1 (NR5A1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.