Tyrosine-protein phosphatase non-receptor type 5 Recombinant Protein | PTPN5 recombinant protein

Recombinant Human Tyrosine-protein phosphatase non-receptor type 5

Cat. Num. AAA963965

• Gene Names: PTPN5; STEP; PTPSTEP
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Tyrosine-protein phosphatase non-receptor type 5; Recombinant Human Tyrosine-protein phosphatase non-receptor type 5; Neural-specific protein-tyrosine phosphatase; Striatum-enriched protein-tyrosine phosphatase; STEP; PTPN5 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 300-555aa; Partial
• Sequence: LQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIIVHCSAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLY
• Sequence Length: 555

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for PTPN5 recombinant protein

May regulate the activity of several effector molecules involved in synaptic plasticity and neuronal cell survival, including MAPKs, Src family kinases and NMDA receptors.

Product Categories/Family for PTPN5 recombinant protein

Neuroscience

References

Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007) Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G., Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006)

NCBI and Uniprot Product Information

• NCBI GI #: 90652861
• NCBI GeneID: 84867
• NCBI Accession #: NP_001035059.1
• NCBI GenBank Nucleotide #: NM_001039970.1
• UniProt Accession #: P54829; Q6P1Z2; Q8N2A1; Q8NDP8; B3KXG7; B7Z386; B7ZAF5; D3DQY7
• Molecular Weight: 45.5 kDa
• NCBI Official Full Name: tyrosine-protein phosphatase non-receptor type 5 isoform b
• NCBI Official Synonym Full Names: protein tyrosine phosphatase, non-receptor type 5
• NCBI Official Symbol: PTPN5
• NCBI Official Synonym Symbols: STEP; PTPSTEP
• NCBI Protein Information: tyrosine-protein phosphatase non-receptor type 5
• UniProt Protein Name: Tyrosine-protein phosphatase non-receptor type 5
• Protein Family: Tyrosine-protein phosphatase non-receptor
• UniProt Gene Name: PTPN5
• UniProt Synonym Gene Names: STEP
• UniProt Entry Name: PTN5_HUMAN

Uniprot Description

STEP: a non-receptor protein-tyrosine phosphatase. STEP (striatum enriched phosphatase) Contains a single phosphatase catalytic domain located at the C-terminus. Two alternatively-spliced messages have been described.

Protein type: Membrane protein, multi-pass; EC 3.1.3.48; Motility/polarity/chemotaxis; Protein phosphatase, tyrosine (non-receptor)

Chromosomal Location of Human Ortholog: 11p15.1

Cellular Component: axon; cytosol; endoplasmic reticulum membrane; integral to membrane; perikaryon

Molecular Function: glutamate receptor binding; mitogen-activated protein kinase binding; phosphotyrosine binding; protein binding; protein tyrosine phosphatase activity

Biological Process: negative regulation of MAP kinase activity; positive regulation of protein amino acid phosphorylation; positive regulation of protein import into nucleus, translocation; positive regulation of receptor internalization; protein amino acid dephosphorylation; response to amphetamine; response to drug