Alpha-1-antiproteinase Recombinant Protein | SERPINA1 recombinant protein

Recombinant Rat Alpha-1-antiproteinase

Cat. Num. AAA963275

• Gene Names: Serpina1; Pi; AAT; Spi1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Alpha-1-antiproteinase; Recombinant Rat Alpha-1-antiproteinase; Alpha-1 protease inhibitor; Serpin A1; SERPINA1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 25-411aa; Full Length
• Sequence: EDAQETDTSQQDQSPTYRKISSNLADFAFSLYRELVHQSNTSNIFFSPMSITTAFAMLSLGSKGDTRKQILEGLEFNLTQIPEADIHKAFHHLLQTLNRPDSELQLNTGNGLFVNKNLKLVEKFLEEVKNNYHSEAFSVNFADSEEAKKVINDYVEKGTQGKIVDLMKQLDEDTVFALVNYIFFKGKWKRPFNPEHTRDADFHVDKSTTVKVPMMNRLGMFDMHYCSTLSSWVLMMDYLGNATAIFLLPDDGKMQHLEQTLTKDLISRFLLNRQTRSAILYFPKLSISGTYNLKTLLSSLGITRVFNNDADLSGITEDAPLKLSQAVHKAVLTLDERGTEAAGATVVEAVPMSLPPQVKFDHPFIFMIVESETQSPLFVGKVIDPTR
• Sequence Length: 411

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for SERPINA1 recombinant protein

Inhibitor of serine proteases. Its primary target is elastase, but it also has a moderate affinity for plasmin and thrombin. Irreversibly inhibits trypsin, chymotrypsin and plasminogen activator. The aberrant form inhibits insulin-induced NO synthesis in platelets, decreases coagulation time and has proteolytic activity against insulin and plasmin. Short peptide from AAT: reversible chymotrypsin inhibitor. It also inhibits elastase, but not trypsin. Its major physiological function is the protection of the lower respiratory tract against proteolytic destruction by human leukocyte elastase (HLE).

Product Categories/Family for SERPINA1 recombinant protein

Immunology

References

Cloning and expression in Escherichia coli of full-length complementary DNA coding for human alpha 1-antitrypsin.Bollen A., Herzog A., Cravador A., Herion P., Chuchana P., van der Straten A., Loriau R., Jacobs P., van Elsen A.DNA 2:255-264(1983)

NCBI and Uniprot Product Information

• NCBI GI #: 51036655
• NCBI GeneID: 24648
• NCBI Accession #: NP_071964.2
• NCBI GenBank Nucleotide #: NM_022519.2
• UniProt Accession #: P17475; Q6AYZ5
• Molecular Weight: 45.7 kDa
• NCBI Official Full Name: alpha-1-antiproteinase
• NCBI Official Synonym Full Names: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
• NCBI Official Symbol: Serpina1
• NCBI Official Synonym Symbols: Pi; AAT; Spi1
• UniProt Protein Name: Alpha-1-antiproteinase
• Protein Family: Alpha-1-antitrypsin
• UniProt Gene Name: Serpina1
• UniProt Entry Name: A1AT_RAT

Uniprot Description

SERPINA1: Inhibitor of serine proteases. Its primary target is elastase, but it also has a moderate affinity for plasmin and thrombin. Irreversibly inhibits trypsin, chymotrypsin and plasminogen activator. The aberrant form inhibits insulin-induced NO synthesis in platelets, decreases coagulation time and has proteolytic activity against insulin and plasmin. Defects in SERPINA1 are the cause of alpha-1-antitrypsin deficiency (A1ATD). A disorder whose most common manifestation is emphysema, which becomes evident by the third to fourth decade. A less common manifestation of the deficiency is liver disease, which occurs in children and adults, and may result in cirrhosis and liver failure. Environmental factors, particularly cigarette smoking, greatly increase the risk of emphysema at an earlier age. Belongs to the serpin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Inhibitor; Secreted

Cellular Component: endoplasmic reticulum; extracellular region; extracellular space; Golgi apparatus

Molecular Function: endopeptidase inhibitor activity; glycoprotein binding; identical protein binding; protease binding; protein binding; serine-type endopeptidase inhibitor activity

Biological Process: acute-phase response; inflammatory response; protein amino acid N-linked glycosylation; response to chromate; response to cytokine stimulus; response to estradiol stimulus; response to hypoxia; response to inorganic substance; response to lead ion; response to lipopolysaccharide; response to methanol; response to organic cyclic substance; response to peptide hormone stimulus; response to triglyceride