Vascular endothelial growth factor A (VEGFA) Recombinant Protein | VEGFA recombinant protein
Recombinant Chicken Vascular endothelial growth factor A (VEGFA)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Vascular endothelial growth factor A (VEGFA); Recombinant Chicken Vascular endothelial growth factor A (VEGFA); Recombinant Vascular endothelial growth factor A (VEGFA); Vascular endothelial growth factor A; VEGF-A; Vascular permeability factor; VPF; VEGFA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
27-216aa; Full length protein
Sequence
APALGDGERKPNEVIKFLEVYERSFCRTIETLVDIFQEYPDEVEYIFRPSCVPLMRCAGC CGDEGLECVPVDVYNVTMEIARIKPHQSQHIAHMSFLQHSKCDCRPKKDVKNKQEKKSKR GKGKGQKRKRKKGRYKPPSFHCEPCSERRKHLFVQDPQTCKCSCKFTDSRCKSRQLELNE RTCRCEKPRR
Sequence Length
216
Species
Gallus gallus (Chicken)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for VEGFA recombinant protein
This gene is a member of the PDGF/VEGF growth factor family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Elevated levels of this protein is linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. There is also evidence for the use of non-AUG (CUG) translation initiation sites upstream of, and in-frame with the first AUG, leading to additional isoforms.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
25,203 Da
NCBI Official Full Name
vascular endothelial growth factor A isoform 2
UniProt Protein Name
Vascular endothelial growth factor A
UniProt Gene Name
VEGFA
UniProt Synonym Gene Names
VEGF; VEGF-A; VPF
UniProt Entry Name
VEGFA_CHICK
Uniprot Description
Function: Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin
By similarity.
Subunit structure: Homodimer; disulfide-linked. Also found as heterodimer with PGF
By similarity.
Sequence similarities: Belongs to the PDGF/VEGF growth factor family.
Research Articles on VEGFA
Similar Products
Product Notes
The Vascular endothelial growth factor A (VEGFA) vegfa (Catalog #AAA962555) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-216aa; Full length protein. The amino acid sequence is listed below: APALGDGERK PNEVIKFLEV YERSFCRTIE TLVDIFQEYP DEVEYIFRPS CVPLMRCAGC CGDEGLECVP VDVYNVTMEI ARIKPHQSQH IAHMSFLQHS KCDCRPKKDV KNKQEKKSKR GKGKGQKRKR KKGRYKPPSF HCEPCSERRK HLFVQDPQTC KCSCKFTDSR CKSRQLELNE RTCRCEKPRR. It is sometimes possible for the material contained within the vial of "Vascular endothelial growth factor A (VEGFA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
