Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Troponin C, skeletal muscle (TNNC2) Recombinant Protein | TNNC2 recombinant protein

Recombinant Human Troponin C, skeletal muscle (TNNC2)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Troponin C; skeletal muscle (TNNC2); Recombinant Human Troponin C; skeletal muscle; TNNC2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-160aa; Full Length
Sequence
TDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ
Sequence Length
159
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for TNNC2 recombinant protein
Troponin is the central regulatory protein of striated muscle contraction. Tn consists of three components: Tn-I which is the inhibitor of actomyosin ATPase, Tn-T which contains the binding site for tropomyosin and Tn-C. The binding of calcium to Tn-C abolishes the inhibitory action of Tn on actin filaments.
Product Categories/Family for TNNC2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45 kDa
NCBI Official Full Name
troponin C, skeletal muscle
NCBI Official Synonym Full Names
troponin C type 2 (fast)
NCBI Official Symbol
TNNC2
NCBI Protein Information
troponin C, skeletal muscle; troponin C2, fast
UniProt Protein Name
Troponin C, skeletal muscle
Protein Family
UniProt Gene Name
TNNC2
UniProt Entry Name
TNNC2_HUMAN

NCBI Description

Troponin (Tn), a key protein complex in the regulation of striated muscle contraction, is composed of 3 subunits. The Tn-I subunit inhibits actomyosin ATPase, the Tn-T subunit binds tropomyosin and Tn-C, while the Tn-C subunit binds calcium and overcomes the inhibitory action of the troponin complex on actin filaments. The protein encoded by this gene is the Tn-C subunit. [provided by RefSeq, Jul 2008]

Uniprot Description

TNNC2: Troponin is the central regulatory protein of striated muscle contraction. Tn consists of three components: Tn-I which is the inhibitor of actomyosin ATPase, Tn-T which contains the binding site for tropomyosin and Tn-C. The binding of calcium to Tn-C abolishes the inhibitory action of Tn on actin filaments. Belongs to the troponin C family.

Protein type: Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 20q12-q13.11

Cellular Component: troponin complex; cytosol

Molecular Function: calcium ion binding; actin binding

Biological Process: skeletal muscle contraction; regulation of muscle contraction; muscle filament sliding

Research Articles on TNNC2

Similar Products

Product Notes

The TNNC2 tnnc2 (Catalog #AAA962478) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-160aa; Full Length. The amino acid sequence is listed below: TDQQAEARSY LSEEMIAEFK AAFDMFDADG GGDISVKELG TVMRMLGQTP TKEELDAIIE EVDEDGSGTI DFEEFLVMMV RQMKEDAKGK SEEELAECFR IFDRNADGYI DPEELAEIFR ASGEHVTDEE IESLMKDGDK NNDGRIDFDE FLKMMEGVQ. It is sometimes possible for the material contained within the vial of "Troponin C, skeletal muscle (TNNC2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.