Ras-related protein Rab-5C Recombinant Protein | RAB5C recombinant protein

Recombinant Human Ras-related protein Rab-5C

Cat. Num. AAA961354

• Gene Names: RAB5C; RABL; L1880; RAB5L; RAB5CL
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ras-related protein Rab-5C; Recombinant Human Ras-related protein Rab-5C; L1880RAB5L; RAB5C recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-216aa; Full Length
• Sequence: MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
• Sequence Length: 249

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for RAB5C recombinant protein

Protein transport. Probably involved in vesicular traffic.

Product Categories/Family for RAB5C recombinant protein

Signal Transduction

References

Isolation and mapping of a human gene (RABL) encoding a small GTP-binding protein homologous to the Ras-related RAB gene.Han H.J., Sudo K., Inazawa J., Nakamura Y.Cytogenet. Cell Genet. 73:137-139(1996) A physical map and candidate genes in the BRCA1 region on chromosome 17q12-21.Albertsen H.M., Smith S.A., Mazoyer S., Fujimoto E., Stevens J., Williams B., Rodriguez P., Cropp C.S., Slijepcevic P., Carlson M., Robertson M., Bradley P., Lawrence E., Harrington T., Sheng Z.M., Hoopes R., Sternberg N., Brothman A., Callahan R., Ponder B.A.J., White R.Nat. Genet. 7:472-479(1994) Deviant expression of Rab5 on phagosomes containing the intracellular pathogens Mycobacterium tuberculosis and Legionella pneumophila is associated with altered phagosomal fate.Clemens D.L., Lee B.-Y., Horwitz M.A.Infect. Immun. 68:2671-2684(2000) cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org) .Puhl H.L. III, Ikeda S.R., Aronstam R.S. Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 354721184
• NCBI GeneID: 5878
• NCBI Accession #: NP_001238968.1
• NCBI GenBank Nucleotide #: NM_001252039.1
• UniProt Accession #: P51148; Q6FH55; Q9P0Y5; F8W1H5
• Molecular Weight: 39.5 kDa
• NCBI Official Full Name: ras-related protein Rab-5C isoform b
• NCBI Official Synonym Full Names: RAB5C, member RAS oncogene family
• NCBI Official Symbol: RAB5C
• NCBI Official Synonym Symbols: RABL; L1880; RAB5L; RAB5CL
• NCBI Protein Information: ras-related protein Rab-5C
• UniProt Protein Name: Ras-related protein Rab-5C
• Protein Family: Ras-related protein
• UniProt Gene Name: RAB5C
• UniProt Synonym Gene Names: RABL
• UniProt Entry Name: RAB5C_HUMAN

NCBI Description

Members of the Rab protein family are small GTPases of the Ras superfamily that are thought to ensure fidelity in the process of docking and/or fusion of vesicles with their correct acceptor compartment (Han et al., 1996 [PubMed 8646882]).[supplied by OMIM, Nov 2010]

Uniprot Description

RAB5C: Protein transport. Probably involved in vesicular traffic. Belongs to the small GTPase superfamily. Rab family.

Protein type: G protein, monomeric; Motility/polarity/chemotaxis; G protein, monomeric, Rab; G protein

Chromosomal Location of Human Ortholog: 17q21.2

Cellular Component: early endosome; early endosome membrane; endocytic vesicle; intracellular membrane-bound organelle; lipid particle; lysosomal membrane; melanosome; plasma membrane

Molecular Function: GDP binding; GTP binding; GTPase activity; protein binding

Biological Process: endosome organization and biogenesis; plasma membrane to endosome transport; protein transport; regulation of endocytosis; small GTPase mediated signal transduction