Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CBFBSample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlCBFB is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit CBFB Polyclonal Antibody | anti-CBFB antibody

CBFB Antibody - N-terminal region

Gene Names
CBFB; PEBP2B
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CBFB; Polyclonal Antibody; CBFB Antibody - N-terminal region; anti-CBFB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRD
Sequence Length
182
Applicable Applications for anti-CBFB antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 82%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CBFB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CBFBSample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlCBFB is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Western Blot (WB) (Host: RabbitTarget Name: CBFBSample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlCBFB is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-CBFB antibody
This is a rabbit polyclonal antibody against CBFB. It was validated on Western Blot

Target Description: CBFB encodes a protein that is the beta subunit of a heterodimeric core-binding transcription factor belonging to the PEBP2/CBF transcription factor family which master-regulates a host of genes specific to hematopoiesis (e.g., RUNX1) and osteogenesis (e.g., RUNX2). The beta subunit is a non-DNA binding regulatory subunit; it allosterically enhances DNA binding by alpha subunit as the complex binds to the core site of various enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers and GM-CSF promoters.
Product Categories/Family for anti-CBFB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
865
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
core-binding factor subunit beta isoform 2
NCBI Official Synonym Full Names
core-binding factor subunit beta
NCBI Official Symbol
CBFB
NCBI Official Synonym Symbols
PEBP2B
NCBI Protein Information
core-binding factor subunit beta
UniProt Protein Name
Core-binding factor subunit beta
Protein Family
UniProt Gene Name
CBFB
UniProt Synonym Gene Names
CBF-beta; PEA2-beta; PEBP2-beta
UniProt Entry Name
PEBB_HUMAN

NCBI Description

The protein encoded by this gene is the beta subunit of a heterodimeric core-binding transcription factor belonging to the PEBP2/CBF transcription factor family which master-regulates a host of genes specific to hematopoiesis (e.g., RUNX1) and osteogenesis (e.g., RUNX2). The beta subunit is a non-DNA binding regulatory subunit; it allosterically enhances DNA binding by alpha subunit as the complex binds to the core site of various enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers and GM-CSF promoters. Alternative splicing generates two mRNA variants, each encoding a distinct carboxyl terminus. In some cases, a pericentric inversion of chromosome 16 [inv(16)(p13q22)] produces a chimeric transcript consisting of the N terminus of core-binding factor beta in a fusion with the C-terminal portion of the smooth muscle myosin heavy chain 11. This chromosomal rearrangement is associated with acute myeloid leukemia of the M4Eo subtype. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CBFB: CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL3 and GM- CSF promoters. CBFB enhances DNA binding by RUNX1. A chromosomal aberration involving CBFB is associated with acute myeloid leukemia of M4EO subtype. Pericentric inversion inv(16)(p13;q22). The inversion produces a fusion protein that consists of the 165 N-terminal residues of CBF-beta (PEPB2) with the tail region of MYH11. Belongs to the CBF-beta family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Oncoprotein; DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: membrane; nucleus

Molecular Function: protein binding; DNA binding; transcription coactivator activity; transcription factor activity

Biological Process: osteoblast differentiation; transcription from RNA polymerase II promoter; lymphocyte differentiation; cell maturation; myeloid cell differentiation; positive regulation of transcription from RNA polymerase II promoter

Research Articles on CBFB

Similar Products

Product Notes

The CBFB cbfb (Catalog #AAA3200308) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CBFB Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CBFB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CBFB cbfb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MPRVVPDQRS KFENEEFFRK LSRECEIKYT GFRDRPHEER QARFQNACRD. It is sometimes possible for the material contained within the vial of "CBFB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.