Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein SCO1 homolog, mitochondrial (SCO1) Recombinant Protein | SCO1 recombinant protein

Recombinant Bovine Protein SCO1 homolog, mitochondrial (SCO1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein SCO1 homolog; mitochondrial (SCO1); Recombinant Bovine Protein SCO1 homolog; SCO1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
68-305, Full length protein
Sequence
STAMPPPPGSSGPEWKGSGDPMRPSKPGPVSWKSLAVTFAIGGALLAGMKYFKKEKTEKLEKERHRSIGKPLLGGPFSLTTHTGEPKTDKDYLGQWVLIYFGFTHCPDICPEELEKMIQVVDEIDSIPTLPNLTPLFITIDPERDTKEAIANYVKEFSPKLIGLTGTKEEIDQVARAFRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKKNAEIAGSIAAHMRTHRKKS
Sequence Length
238
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for SCO1 recombinant protein
Mammalian cytochrome c oxidase (COX) catalyzes the transfer of reducing equivalents from cytochrome c to molecular oxygen and pumps protons across the inner mitochondrial membrane. In yeast, 2 related COX assembly genes, SCO1 and SCO2 (synthesis of cytochrome c oxidase), enable subunits 1 and 2 to be incorporated into the holoprotein. This gene is the human homolog to the yeast SCO1 gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,658 Da
NCBI Official Full Name
protein SCO1 homolog, mitochondrial
NCBI Official Synonym Full Names
SCO1, cytochrome c oxidase assembly protein
NCBI Official Symbol
SCO1
NCBI Protein Information
protein SCO1 homolog, mitochondrial
UniProt Protein Name
Protein SCO1 homolog, mitochondrial
Protein Family
UniProt Gene Name
SCO1
UniProt Synonym Gene Names
SCOD1

Uniprot Description

Thought to play a role in cellular copper homeostasis, mitochondrial redox signaling or insertion of copper into the active site of MT-CO2/COX2.

Similar Products

Product Notes

The SCO1 sco1 (Catalog #AAA960673) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 68-305, Full length protein. The amino acid sequence is listed below: STAMPPPPGS SGPEWKGSGD PMRPSKPGPV SWKSLAVTFA IGGALLAGMK YFKKEKTEKL EKERHRSIGK PLLGGPFSLT THTGEPKTDK DYLGQWVLIY FGFTHCPDIC PEELEKMIQV VDEIDSIPTL PNLTPLFITI DPERDTKEAI ANYVKEFSPK LIGLTGTKEE IDQVARAFRV YYSPGPKDED EDYIVDHTII MYLIGPDGEF LDYFGQNKKN AEIAGSIAAH MRTHRKKS. It is sometimes possible for the material contained within the vial of "Protein SCO1 homolog, mitochondrial (SCO1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.