Pituitary-specific positive transcription factor 1 (Pou1f1) Recombinant Protein | Pou1f1 recombinant protein
Recombinant Mouse Pituitary-specific positive transcription factor 1 (Pou1f1)
Gene Names
Pou1f1; dw; Hmp1; Pit1; GHF-1; Pit-1; dwarf; Pit1-rs1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pituitary-specific positive transcription factor 1 (Pou1f1); Recombinant Mouse Pituitary-specific positive transcription factor 1 (Pou1f1); Pou1f1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-291, Full length protein
Sequence
MSCQSFTSADTFITLNSDASAALPLRMHHSAAECLPASNHATNVMSTATGLHYSVPSCHYGNQPSTYGVMAGSLTPCLYKFPDHTLSHGFPPLHQPLLAEDPAASEFKQELRRKSKLVEEPIDMDSPEIRELEQFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISVAAKDALERHFGEHSKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR
Sequence Length
291
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Pou1f1 recombinant protein
This gene encodes a member of the POU family of transcription factors that regulate mammalian development. The protein regulates expression of several genes involved in pituitary development and hormone expression. Mutations in this genes result in combined pituitary hormone deficiency. Multiple transcript variants encoding different isoforms have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,752 Da
NCBI Official Full Name
pituitary-specific positive transcription factor 1
NCBI Official Synonym Full Names
POU domain, class 1, transcription factor 1
NCBI Official Symbol
Pou1f1
NCBI Official Synonym Symbols
dw; Hmp1; Pit1; GHF-1; Pit-1; dwarf; Pit1-rs1
NCBI Protein Information
pituitary-specific positive transcription factor 1
UniProt Protein Name
Pituitary-specific positive transcription factor 1
Protein Family
UniProt Gene Name
Pou1f1
UniProt Synonym Gene Names
Pit-1; Pit1; PIT-1; GHF-1
Uniprot Description
Transcription factor involved in the specification of the lactotrope, somatotrope, and thyrotrope phenotypes in the developing anterior pituitary. Activates growth hormone and prolactin genes. Specifically binds to the consensus sequence 5'-TAAAT-3'.
Research Articles on Pou1f1
Similar Products
Product Notes
The Pou1f1 pou1f1 (Catalog #AAA958930) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-291, Full length protein. The amino acid sequence is listed below: MSCQSFTSAD TFITLNSDAS AALPLRMHHS AAECLPASNH ATNVMSTATG LHYSVPSCHY GNQPSTYGVM AGSLTPCLYK FPDHTLSHGF PPLHQPLLAE DPAASEFKQE LRRKSKLVEE PIDMDSPEIR ELEQFANEFK VRRIKLGYTQ TNVGEALAAV HGSEFSQTTI CRFENLQLSF KNACKLKAIL SKWLEEAEQV GALYNEKVGA NERKRKRRTT ISVAAKDALE RHFGEHSKPS SQEIMRMAEE LNLEKEVVRV WFCNRRQREK RVKTSLNQSL FSISKEHLEC R. It is sometimes possible for the material contained within the vial of "Pituitary-specific positive transcription factor 1 (Pou1f1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
