Mouse anti-Human, Rat ERO1L Monoclonal Antibody | anti-ERO1L antibody

ERO1L (ERO1-like Protein alpha, ERO1-L, ERO1-L-alpha, Endoplasmic Oxidoreductin-1-like Protein, Oxidoreductin-1-L-alpha, UNQ434/PRO865) (FITC)

Cat. Num. AAA6147078

• Gene Names: ERO1A; ERO1L; ERO1-L; ERO1LA; Ero1alpha; ERO1-alpha; ERO1-L-alpha
• Reactivity: Human, Rat
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ERO1L; Monoclonal Antibody; ERO1L (ERO1-like Protein alpha; ERO1-L; ERO1-L-alpha; Endoplasmic Oxidoreductin-1-like Protein; Oxidoreductin-1-L-alpha; UNQ434/PRO865) (FITC); anti-ERO1L antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4G3
• Specificity: Recognizes human ERO1L. Species Crossreactivity: rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-ERO1L antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 1.5ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa90-179 from human ERO1L (NP_055399) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEY
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.9kD).)

Western Blot (WB)

(ERO1L monoclonal antibody, Western Blot analysis of ERO1L expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of ERO1L expression in transfected 293T cell line by ERO1L monoclonal antibody. Lane 1: ERO1L transfected lysate (54kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ERO1L on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ERO1L is ~3ng/ml as a capture antibody.)

Western Blot (WB)

(ERO1L monoclonal antibody. Western Blot analysis of ERO1L expression in PC-12.)

Product Categories/Family for anti-ERO1L antibody

Antibodies; Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 7657069
• NCBI GeneID: 30001
• NCBI Accession #: NP_055399
• NCBI GenBank Nucleotide #: NM_014584
• UniProt Accession #: Q96HE7; Q7LD45; Q9P1Q9; Q9UKV6; A8K9X4; A8MYW1
• Molecular Weight: 54.4 kDa (468aa)
• NCBI Official Full Name: ERO1-like protein alpha
• NCBI Official Synonym Full Names: endoplasmic reticulum oxidoreductase 1 alpha
• NCBI Official Symbol: ERO1A
• NCBI Official Synonym Symbols: ERO1L; ERO1-L; ERO1LA; Ero1alpha; ERO1-alpha; ERO1-L-alpha
• NCBI Protein Information: ERO1-like protein alpha
• UniProt Protein Name: ERO1-like protein alpha
• Protein Family: Ero1-like protein
• UniProt Gene Name: ERO1A
• UniProt Synonym Gene Names: ERO1-L; ERO1-L-alpha

Uniprot Description

Oxidoreductase involved in disulfide bond formation in the endoplasmic reticulum. Efficiently reoxidizes P4HB/PDI, the enzyme catalyzing protein disulfide formation, in order to allow P4HB to sustain additional rounds of disulfide formation. Following P4HB reoxidation, passes its electrons to molecular oxygen via FAD, leading to the production of reactive oxygen species (ROS) in the cell. Required for the proper folding of immunoglobulins. Involved in the release of the unfolded cholera toxin from reduced P4HB/PDI in case of infection by V.cholerae, thereby playing a role in retrotranslocation of the toxin. Plays an important role in ER stress-induced, CHOP-dependent apoptosis by activating the inositol 1,4,5-trisphosphate receptor IP3R1.