POU domain, class 3, transcription factor 4 (Pou3f4) Recombinant Protein | Pou3f4 recombinant protein
Recombinant Rat POU domain, class 3, transcription factor 4 (Pou3f4)
Gene Names
Pou3f4; RHS2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
POU domain; class 3; transcription factor 4 (Pou3f4); Recombinant Rat POU domain; Pou3f4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-361, Full length protein
Sequence
MATAASNPYSILSSSSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNHPNAWGASPAPNSSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASTQSLHPVLREPPDHGELGSHHCQDHSDEETPTSDELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGDQQPHEVYSHTVKTDASCHDL
Sequence Length
361
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Pou3f4 recombinant protein
This gene encodes a member of the POU-III class of neural transcription factors. This gene may play a role in the mediation of epigenetic signals which induce striatal neuron-precursor differentiation. Mutations have been associated with X chromosome-linked nonsyndromic mixed deafness.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
39,417 Da
NCBI Official Full Name
POU domain, class 3, transcription factor 4
NCBI Official Synonym Full Names
POU class 3 homeobox 4
NCBI Official Symbol
Pou3f4
NCBI Official Synonym Symbols
RHS2
NCBI Protein Information
POU domain, class 3, transcription factor 4
UniProt Protein Name
POU domain, class 3, transcription factor 4
Protein Family
UniProt Gene Name
Pou3f4
UniProt Synonym Gene Names
Brn-4; Brn4; Otf9; Brain-4; Brn-4; Oct-9; OTF-9
NCBI Description
binds octamer motif containing DNA sequences; acts as a transcriptional transactivator; may play a role in early neural development [RGD, Feb 2006]
Uniprot Description
Probable transcription factor which exert its primary action widely during early neural development and in a very limited set of neurons in the mature brain.
Research Articles on Pou3f4
Similar Products
Product Notes
The Pou3f4 pou3f4 (Catalog #AAA958201) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-361, Full length protein. The amino acid sequence is listed below: MATAASNPYS ILSSSSLVHA DSAGMQQGSP FRNPQKLLQS DYLQGVPSNG HPLGHHWVTS LSDGGPWSST LATSPLDQQD VKPGREDLQL GAIIHHRSPH VAHHSPHTNH PNAWGASPAP NSSITSSGQP LNVYSQPGFT VSGMLEHGGL TPPPAAASTQ SLHPVLREPP DHGELGSHHC QDHSDEETPT SDELEQFAKQ FKQRRIKLGF TQADVGLALG TLYGNVFSQT TICRFEALQL SFKNMCKLKP LLNKWLEEAD SSTGSPTSID KIAAQGRKRK KRTSIEVSVK GVLETHFLKC PKPAAQEISS LADSLQLEKE VVRVWFCNRR QKEKRMTPPG DQQPHEVYSH TVKTDASCHD L. It is sometimes possible for the material contained within the vial of "POU domain, class 3, transcription factor 4 (Pou3f4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
