Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Tumor necrosis factor ligand superfamily member 10 (Tnfsf10) Recombinant Protein | Tnfsf10 recombinant protein

Recombinant Mouse Tumor necrosis factor ligand superfamily member 10 (Tnfsf10), partial

Gene Names
Tnfsf10; TL2; Ly81; Trail; APO-2L; Tnlg6a; AI448571; A330042I21Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor necrosis factor ligand superfamily member 10 (Tnfsf10); Recombinant Mouse Tumor necrosis factor ligand superfamily member 10 (Tnfsf10); partial; Tnfsf10 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
39-291\naa, Extracellular domain
Sequence
YMYFTNEMKQLQDNYSKIGLACFSKTDEDFWDSTDGEILNRPCLQVKRQLYQLIEEVTLRTFQDTISTVPEKQLSTPPLPRGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN
Sequence Length
291
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Tnfsf10 recombinant protein
This protein is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein preferentially induces apoptosis in transformed and tumor cells, but does not appear to kill normal cells although it is expressed at a significant level in most normal tissues. This protein binds to several members of TNF receptor superfamily including TNFRSF10A
TRAILR1, TNFRSF10B
TRAILR2, TNFRSF10C
TRAILR3, TNFRSF10D
TRAILR4, and possibly also to TNFRSF11B
OPG. The activity of this protein may be modulated by binding to the decoy receptors TNFRSF10C
TRAILR3, TNFRSF10D
TRAILR4, and TNFRSF11B
OPG that cannot induce apoptosis. The binding of this protein to its receptors has been shown to trigger the activation of MAPK8
JNK, caspase 8, and caspase 3.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,477 Da
NCBI Official Full Name
tumor necrosis factor ligand superfamily member 10
NCBI Official Synonym Full Names
tumor necrosis factor (ligand) superfamily, member 10
NCBI Official Symbol
Tnfsf10
NCBI Official Synonym Symbols
TL2; Ly81; Trail; APO-2L; Tnlg6a; AI448571; A330042I21Rik
NCBI Protein Information
tumor necrosis factor ligand superfamily member 10
UniProt Protein Name
Tumor necrosis factor ligand superfamily member 10
UniProt Gene Name
Tnfsf10
UniProt Synonym Gene Names
Trail; Protein TRAIL

Uniprot Description

Cytokine that binds to TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and possibly also to TNFRSF11B/OPG. Induces apoptosis. Its activity may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and TNFRSF11B/OPG that cannot induce apoptosis.

Research Articles on Tnfsf10

Similar Products

Product Notes

The Tnfsf10 tnfsf10 (Catalog #AAA956864) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 39-291naa, Extracellular domain. The amino acid sequence is listed below: YMYFTNEMKQ LQDNYSKIGL ACFSKTDEDF WDSTDGEILN RPCLQVKRQL YQLIEEVTLR TFQDTISTVP EKQLSTPPLP RGGRPQKVAA HITGITRRSN SALIPISKDG KTLGQKIESW ESSRKGHSFL NHVLFRNGEL VIEQEGLYYI YSQTYFRFQE AEDASKMVSK DKVRTKQLVQ YIYKYTSYPD PIVLMKSARN SCWSRDAEYG LYSIYQGGLF ELKKNDRIFV SVTNEHLMDL DQEASFFGAF LIN. It is sometimes possible for the material contained within the vial of "Tumor necrosis factor ligand superfamily member 10 (Tnfsf10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.