Tricarboxylate transport protein, mitochondrial (SLC25A1) Recombinant Protein | SLC25A1 recombinant protein
Recombinant Bovine Tricarboxylate transport protein, mitochondrial (SLC25A1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tricarboxylate transport protein; mitochondrial (SLC25A1); Recombinant Bovine Tricarboxylate transport protein; Recombinant Tricarboxylate transport protein; mitochondrial; Citrate transport protein; CTP Solute carrier family 25 member 1 Tricarboxylate carrier protein; SLC25A1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
14-311
Sequence
SPGSGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGLLGLYRGLSSLLYGSIPKAAVRFGTFEFLSNHMRDAQGRLDSTRGLLCGLGAGVPEAVVVVCPMETIKVKFIHDQTSASPKYRGFFHGVREIVREQGLKGTYQGLTATVLKQGSNQGIRFFVMTSLRNWYRGDNPNKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTLDCGLQILRNEGLKAFYKGTVPRLGRVCLDVAIVFIIYDEVVKLLNKVWKAD
Sequence Length
311
Species
Bos taurus (Bovine)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,876 Da
NCBI Official Full Name
tricarboxylate transport protein, mitochondrial
NCBI Official Synonym Full Names
solute carrier family 25 (mitochondrial carrier; citrate transporter), member 1<
NCBI Official Symbol
SLC25A1
NCBI Protein Information
tricarboxylate transport protein, mitochondrial; CTP; citrate transport protein; tricarboxylate carrier protein; solute carrier family 25 member 1; solute carrier family 25, member 1
UniProt Protein Name
Tricarboxylate transport protein, mitochondrial
UniProt Gene Name
SLC25A1
UniProt Synonym Gene Names
SLC20A3; CTP
UniProt Entry Name
TXTP_BOVIN
Uniprot Description
Function: Involved in citrate-H+/malate exchange. Important for the bioenergetics of hepatic cells as it provides a carbon source for fatty acid and sterol biosyntheses, and NAD+ for the glycolytic pathway.
Subcellular location: Mitochondrion inner membrane; Multi-pass membrane protein.
Sequence similarities: Belongs to the mitochondrial carrier family.Contains 3 Solcar repeats.
Similar Products
Product Notes
The SLC25A1 slc25a1 (Catalog #AAA956285) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 14-311. The amino acid sequence is listed below: SPGSGKAKLT HPGKAILAGG LAGGIEICIT FPTEYVKTQL QLDERSHPPR YRGIGDCVRQ TVRSHGLLGL YRGLSSLLYG SIPKAAVRFG TFEFLSNHMR DAQGRLDSTR GLLCGLGAGV PEAVVVVCPM ETIKVKFIHD QTSASPKYRG FFHGVREIVR EQGLKGTYQG LTATVLKQGS NQGIRFFVMT SLRNWYRGDN PNKPMNPLIT GVFGAIAGAA SVFGNTPLDV IKTRMQGLEA HKYRNTLDCG LQILRNEGLK AFYKGTVPRL GRVCLDVAIV FIIYDEVVKL LNKVWKAD. It is sometimes possible for the material contained within the vial of "Tricarboxylate transport protein, mitochondrial (SLC25A1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
