(Rhesus macaque) Prostate-specific antigen (KLK3) Recombinant Protein | KLK3 recombinant protein
Recombinant Macaca mulatta (Rhesus macaque) Prostate-specific antigen (KLK3)
Gene Names
KLK3; PSA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
(Rhesus macaque) Prostate-specific antigen (KLK3); Recombinant Macaca mulatta (Rhesus macaque) Prostate-specific antigen (KLK3); Recombinant (Rhesus macaque) Prostate-specific antigen (KLK3); Prostate-specific antigen; PSA EC= 3.4.21.77; Kallikrein-3 Semenogelase; KLK3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-261
Sequence
IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRSNSVILLGRHNPYYPEDTGQVFQVSHSFPHPLYNMSLLKNRYLGPGDDSSHDLMLLRLSEPAEITDAVQVLDLPTWEPELGTTCYASGWGSIEPEEHLTPKKLQCVDLHIISNDVCAQVHSQKVTKFMLCAGSWMGGKSTCSGDSGGPLVCDGVLQGITSWGSQPCALPRRPSLYTKVVRYRKWIQDTIMANP
Sequence Length
261
Species
Macaca mulatta (Rhesus macaque)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,816 Da
NCBI Official Full Name
prostate-specific antigen
NCBI Official Symbol
KLK3
NCBI Official Synonym Symbols
PSA
NCBI Protein Information
prostate-specific antigen; kallikrein-3; semenogelase; prostate specific antigen; kallikrein-related peptidase 3
UniProt Protein Name
Prostate-specific antigen
Protein Family
UniProt Gene Name
KLK3
UniProt Synonym Gene Names
APS; PSA
UniProt Entry Name
KLK3_MACMU
Uniprot Description
Function: Hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum
By similarity.
Catalytic activity: Preferential cleavage: -Tyr-|-Xaa-.
Enzyme regulation: Inhibited by SERPINA5. Activity is strongly inhibited by Zn2+, 100 times more abundant in semen than in serum. This inhibition is relieved by exposure to semenogelins, which are avid zinc binders
By similarity.
Subunit structure: Forms heterodimer with SERPINA5
By similarity.
Subcellular location: Secreted
By similarity.
Sequence similarities: Belongs to the peptidase S1 family. Kallikrein subfamily.Contains 1 peptidase S1 domain.
Similar Products
Product Notes
The KLK3 klk3 (Catalog #AAA955480) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-261. The amino acid sequence is listed below: IVGGWECEKH SQPWQVLVAS RGRAVCGGVL VHPQWVLTAA HCIRSNSVIL LGRHNPYYPE DTGQVFQVSH SFPHPLYNMS LLKNRYLGPG DDSSHDLMLL RLSEPAEITD AVQVLDLPTW EPELGTTCYA SGWGSIEPEE HLTPKKLQCV DLHIISNDVC AQVHSQKVTK FMLCAGSWMG GKSTCSGDSG GPLVCDGVLQ GITSWGSQPC ALPRRPSLYT KVVRYRKWIQ DTIMANP. It is sometimes possible for the material contained within the vial of "(Rhesus macaque) Prostate-specific antigen (KLK3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
