Western Blot (WB)
(WB Suggested Anti-LMX1B Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)
Rabbit LMX1B Polyclonal Antibody | anti-LMX1B antibody
LMX1B antibody - C-terminal region
Gene Names
LMX1B; NPS1; LMX1.2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
LMX1B; Polyclonal Antibody; LMX1B antibody - C-terminal region; anti-LMX1B antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QSPYGSSDPFQQGLTPPQMPGNDSIFHDIDSDTSLTSLSDCFLGSSDVGS
Sequence Length
372
Applicable Applications for anti-LMX1B antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human LMX1B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-LMX1B Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)
Western Blot (WB)
(WB Suggested Anti-LMX1B Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)
Related Product Information for anti-LMX1B antibody
This is a rabbit polyclonal antibody against LMX1B. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: LMX1B is essential for the specification of dorsal limb fate at both the zeugopodal and autopodal levels. Defects in LMX1B are the cause of nail-patella syndrome (NPS) also knowan as Onychoosteodysplasia.
Target Description: LMX1B is essential for the specification of dorsal limb fate at both the zeugopodal and autopodal levels. Defects in LMX1B are the cause of nail-patella syndrome (NPS) also knowan as Onychoosteodysplasia.
Product Categories/Family for anti-LMX1B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42kDa
NCBI Official Full Name
LIM homeobox transcription factor 1-beta isoform 1
NCBI Official Synonym Full Names
LIM homeobox transcription factor 1 beta
NCBI Official Symbol
LMX1B
NCBI Official Synonym Symbols
NPS1; LMX1.2
NCBI Protein Information
LIM homeobox transcription factor 1-beta
Protein Family
NCBI Description
This gene encodes a member of LIM-homeodomain family of proteins containing two N-terminal zinc-binding LIM domains, 1 homeodomain, and a C-terminal glutamine-rich domain. It functions as a transcription factor, and is essential for the normal development of dorsal limb structures, the glomerular basement membrane, the anterior segment of the eye, and dopaminergic and serotonergic neurons. Mutations in this gene are associated with nail-patella syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010]
Research Articles on LMX1B
Similar Products
Product Notes
The LMX1B (Catalog #AAA3203920) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LMX1B antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's LMX1B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LMX1B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QSPYGSSDPF QQGLTPPQMP GNDSIFHDID SDTSLTSLSD CFLGSSDVGS. It is sometimes possible for the material contained within the vial of "LMX1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
