Glutathione S-transferase theta-2B (GSTT2B) Recombinant Protein | GSTT2B recombinant protein
Recombinant Human Glutathione S-transferase theta-2B (GSTT2B)
Gene Names
GSTT2B; GSTT2P
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glutathione S-transferase theta-2B (GSTT2B); Recombinant Human Glutathione S-transferase theta-2B (GSTT2B); GSTT2B recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-244, Full length protein
Sequence
GLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP
Sequence Length
243
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for GSTT2B recombinant protein
Glutathione S-transferase (GSTs) theta 2 (GSTT2) is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: Alpha, Mu, Pi, Theta, and Zeta. The theta class members GSTT1 and GSTT2 share 55% amino acid sequence identity and both are thought to have an important role in human carcinogenesis. The theta genes have a similar structure, being composed of five exons with identical exon
intron boundaries.
intron boundaries.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27,507 Da
NCBI Official Full Name
glutathione S-transferase theta-2B
NCBI Official Synonym Full Names
glutathione S-transferase theta 2B (gene/pseudogene)
NCBI Official Symbol
GSTT2B
NCBI Official Synonym Symbols
GSTT2P
NCBI Protein Information
glutathione S-transferase theta-2B
UniProt Protein Name
Glutathione S-transferase theta-2B
Protein Family
UniProt Gene Name
GSTT2B
UniProt Synonym Gene Names
GSTT2
NCBI Description
The protein encoded by this gene, glutathione S-transferase (GST) theta 2B (GSTT2B), is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: alpha, mu, pi, theta, and zeta. The theta class includes GSTT1, GSTT2, and GSTT2B. GSTT2 and GSTT2B are nearly identical to each other, and share 55% amino acid identity with GSTT1. All three genes may play a role in human carcinogenesis. The GSTT2B gene is a pseudogene in some populations. [provided by RefSeq, Sep 2015]
Uniprot Description
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has a sulfatase activity.
Research Articles on GSTT2B
Similar Products
Product Notes
The GSTT2B gstt2b (Catalog #AAA954883) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-244, Full length protein. The amino acid sequence is listed below: GLELFLDLVS QPSRAVYIFA KKNGIPLELR TVDLVKGQHK SKEFLQINSL GKLPTLKDGD FILTESSAIL IYLSCKYQTP DHWYPSDLQA RARVHEYLGW HADCIRGTFG IPLWVQVLGP LIGVQVPEEK VERNRTAMDQ ALQWLEDKFL GDRPFLAGQQ VTLADLMALE ELMQPVALGY ELFEGRPRLA AWRGRVEAFL GAELCQEAHS IILSILEQAA KKTLPTPSPE AYQAMLLRIA RIP. It is sometimes possible for the material contained within the vial of "Glutathione S-transferase theta-2B (GSTT2B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
