V-type proton ATPase subunit C 1 (ATP6V1C1) Recombinant Protein | ATP6V1C1 recombinant protein

Recombinant Human V-type proton ATPase subunit C 1 (ATP6V1C1)

Cat. Num. AAA954865

• Gene Names: ATP6V1C1; VATC; Vma5; ATP6C; ATP6D
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: V-type proton ATPase subunit C 1 (ATP6V1C1); Recombinant Human V-type proton ATPase subunit C 1 (ATP6V1C1); ATP6V1C1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-382, Full length protein
• Sequence: TEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK
• Sequence Length: 381

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for ATP6V1C1 recombinant protein

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c , c , and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene is one of two genes that encode the V1 domain C subunit proteins and is found ubiquitously. This C subunit is analogous but not homologous to gamma subunit of F-ATPases. Previously, this gene was designated ATP6D.

NCBI and Uniprot Product Information

• NCBI GI #: 4502315
• NCBI GeneID: 528
• NCBI Accession #: NP_001686.1
• NCBI GenBank Nucleotide #: NM_001695.4
• UniProt Accession #: P21283
• Molecular Weight: 43,942 Da
• NCBI Official Full Name: V-type proton ATPase subunit C 1
• NCBI Official Synonym Full Names: ATPase H+ transporting V1 subunit C1
• NCBI Official Symbol: ATP6V1C1
• NCBI Official Synonym Symbols: VATC; Vma5; ATP6C; ATP6D
• NCBI Protein Information: V-type proton ATPase subunit C 1
• UniProt Protein Name: V-type proton ATPase subunit C 1
• Protein Family: V-type proton ATPase
• UniProt Gene Name: ATP6V1C1
• UniProt Synonym Gene Names: ATP6C; ATP6D; VATC; V-ATPase subunit C 1

NCBI Description

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene is one of two genes that encode the V1 domain C subunit proteins and is found ubiquitously. This C subunit is analogous but not homologous to gamma subunit of F-ATPases. Previously, this gene was designated ATP6D. [provided by RefSeq, Jul 2008]

Uniprot Description

Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.