Endoplasmic reticulum resident protein 29 (ERP29) Recombinant Protein | ERP29 recombinant protein
Recombinant Human Endoplasmic reticulum resident protein 29 (ERP29)
Gene Names
ERP29; ERp28; ERp31; PDIA9; PDI-DB; C12orf8; HEL-S-107
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Endoplasmic reticulum resident protein 29 (ERP29); Recombinant Human Endoplasmic reticulum resident protein 29 (ERP29); ERP29 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
33-261, Full length protein
Sequence
LHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL
Sequence Length
229
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for ERP29 recombinant protein
This gene encodes a reticuloplasmin, a protein which resides in the lumen of the endoplasmic reticulum (ER). The protein shows sequence similarity to the protein disulfide isomerase family. However, it lacks the thioredoxin motif characteristic of this family, suggesting that this protein does not function as a disulfide isomerase. The protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
5,477 Da
NCBI Official Full Name
endoplasmic reticulum resident protein 29 isoform 2
NCBI Official Synonym Full Names
endoplasmic reticulum protein 29
NCBI Official Symbol
ERP29
NCBI Official Synonym Symbols
ERp28; ERp31; PDIA9; PDI-DB; C12orf8; HEL-S-107
NCBI Protein Information
endoplasmic reticulum resident protein 29
UniProt Protein Name
Endoplasmic reticulum resident protein 29
Protein Family
UniProt Gene Name
ERP29
UniProt Synonym Gene Names
C12orf8; ERP28; ERp29; ERp28; ERp31
NCBI Description
This gene encodes a protein which localizes to the lumen of the endoplasmic reticulum (ER). It is a member of the protein disulfide isomerase (PDI) protein family but lacks an active thioredoxin motif, suggesting that this protein does not function as a disulfide isomerase. The canonical protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2016]
Uniprot Description
Does not seem to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER.
Research Articles on ERP29
Similar Products
Product Notes
The ERP29 erp29 (Catalog #AAA953850) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 33-261, Full length protein. The amino acid sequence is listed below: LHTKGALPLD TVTFYKVIPK SKFVLVKFDT QYPYGEKQDE FKRLAENSAS SDDLLVAEVG ISDYGDKLNM ELSEKYKLDK ESYPVFYLFR DGDFENPVPY TGAVKVGAIQ RWLKGQGVYL GMPGCLPVYD ALAGEFIRAS GVEARQALLK QGQDNLSSVK ETQKKWAEQY LKIMGKILDQ GEDFPASEMT RIARLIEKNK MSDGKKEELQ KSLNILTAFQ KKGAEKEEL. It is sometimes possible for the material contained within the vial of "Endoplasmic reticulum resident protein 29 (ERP29), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
