Transcription factor GATA-5 (GATA5) Recombinant Protein | GATA5 recombinant protein
Recombinant Chicken Transcription factor GATA-5 (GATA5)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transcription factor GATA-5 (GATA5); Recombinant Chicken Transcription factor GATA-5 (GATA5); GATA5 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-391, Full length protein
Sequence
MYQGLALAPNHGQSAYSHDSGNFLHSSAGSPVYVPTTRVPSVLQTLPYLQSCEPHQSHLGNPPGWAQSSGETTAFNAGSPHPPSGFSYPHSPRAAAPRGVDGAYQGPLLLGGGGREQYGNALVRSVNGSYSSPYPAYVTPELPPSWTAGHFESSVLHSLQTRQAALPGRRSTFEYLEEFPGDGRECVNCGAMSTPLWRKDGTGHYLCNACGLYHKMNGINRPLKPQKRLSSSRRAGLCCTNCHTTNTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKESIQTRKRKPKNITKGKTSTGSTTSATNSPSSITNSDSTVTLKSEPSTTSQYPGQGIVSVSQAQSQSDEALAGGEFKFEPEDYPFSPSSMAPQPGLSVPLRQDSWCALALA
Sequence Length
391
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for GATA5 recombinant protein
This protein is a transcription factor that contains two GATA-type zinc fingers. The encoded protein is known to bind to hepatocyte nuclear factor-1alpha (HNF-1alpha), and this interaction is essential for cooperative activation of the intestinal lactase-phlorizin hydrolase promoter. In other organisms, similar proteins may be involved in the establishment of cardiac smooth muscle cell diversity.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
41,859 Da
NCBI Official Full Name
Transcription factor GATA-5
UniProt Protein Name
Transcription factor GATA-5
Protein Family
UniProt Gene Name
GATA5
Uniprot Description
Probably involved in bone morphogenetic protein (BMP)-mediated cardiac-specific gene expression. Binds to BMP response element (BMPRE) DNA sequences within cardiac activating regions.
Similar Products
Product Notes
The GATA5 gata5 (Catalog #AAA953787) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-391, Full length protein. The amino acid sequence is listed below: MYQGLALAPN HGQSAYSHDS GNFLHSSAGS PVYVPTTRVP SVLQTLPYLQ SCEPHQSHLG NPPGWAQSSG ETTAFNAGSP HPPSGFSYPH SPRAAAPRGV DGAYQGPLLL GGGGREQYGN ALVRSVNGSY SSPYPAYVTP ELPPSWTAGH FESSVLHSLQ TRQAALPGRR STFEYLEEFP GDGRECVNCG AMSTPLWRKD GTGHYLCNAC GLYHKMNGIN RPLKPQKRLS SSRRAGLCCT NCHTTNTTLW RRNAEGEPVC NACGLYMKLH GVPRPLAMKK ESIQTRKRKP KNITKGKTST GSTTSATNSP SSITNSDSTV TLKSEPSTTS QYPGQGIVSV SQAQSQSDEA LAGGEFKFEP EDYPFSPSSM APQPGLSVPL RQDSWCALAL A. It is sometimes possible for the material contained within the vial of "Transcription factor GATA-5 (GATA5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
