Kallikrein-7 Recombinant Protein | KLK7 recombinant protein

Recombinant Human Kallikrein-7 protein

Cat. Num. AAA952890

• Gene Names: KLK7; hK7; SCCE; PRSS6
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Kallikrein-7; Recombinant Human Kallikrein-7 protein; Serine protease 6; Stratum corneum chymotryptic enzyme; hSCCE; KLK7 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 28-253aa; Full Length
• Sequence: DKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
• Sequence Length: 181

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for KLK7 recombinant protein

May catalyze the degradation of intercellular cohesive structures in the cornified layer of the skin in the continuous shedding of cells from the skin surface. Specific for amino acid residues with aromatic side chains in the P1 position. Cleaves insulin A chain at '14-Tyr-|-Gln-15' and insulin B chain at '6-Leu-|-Cys-7', '16-Tyr-|-Leu-17', '25-Phe-|-Tyr-26' and '26-Tyr-|-Thr-27'. Could play a role in the activation of precursors to inflammatory cytokines.

Product Categories/Family for KLK7 recombinant protein

Cancer

References

Cloning, expression, and characterization of stratum corneum chymotryptic enzyme. A skin-specific human serine proteinase.Hansson L., Stroemqvist M., Baeckman A., Wallbrandt P., Carlstein A., Egelrud T.J. Biol. Chem. 269:19420-19426(1994) The KLK7 (PRSS6) gene, encoding for the stratum corneum chymotryptic enzyme is a new member of the human kallikrein gene family -- genomic characterization, mapping, tissue expression and hormonal regulation.Yousef G.M., Scorilas A., Magklara A., Soosaipillai A., Diamandis E.P.Gene 254:119-128(2000) Sequencing and expression analysis of the serine protease gene cluster located in chromosome 19q13 region.Gan L., Lee I., Smith R., Argonza-Barrett R., Lei H., McCuaig J., Moss P., Paeper B., Wang K.Gene 257:119-130(2000) Epidermal overexpression of stratum corneum chymotryptic enzyme in mice a model for chronic itchy dermatitis.Hansson L., Backman A., Ny A., Edlund M., Ekholm E., Ekstrand Hammarstrom B., Tornell J., Wallbrandt P., Wennbo H., Egelrud T.J. Invest. Dermatol. 118:444-449(2002) Differential splicing of KLK5 and KLK7 in epithelial ovarian cancer produces novel variants with potential as cancer biomarkers.Dong Y., Kaushal A., Brattsand M., Nicklin J., Clements J.A.Clin. Cancer Res. 9:1710-1720(2003) Prostate epithelial cells KLK7 protein.Mo Z., Yang X. Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C. Primary substrate specificity of recombinant human stratum corneum chymotryptic enzyme.Skytt A., Stroemqvist M., Egelrud T.Biochem. Biophys. Res. Commun. 211:586-589(1995) Vaspin inhibits kallikrein 7 by serpin mechanism.Heiker J.T., Kloting N., Kovacs P., Kuettner E.B., Strater N., Schultz S., Kern M., Stumvoll M., Bluher M., Beck-Sickinger A.G.Cell. Mol. Life Sci. 70:2569-2583(2013) Chymotryptic specificity determinants in the 1.0 A structure of the zinc-inhibited human tissue kallikrein 7.Debela M., Hess P., Magdolen V., Schechter N.M., Steiner T., Huber R., Bode W., Goettig P.Proc. Natl. Acad. Sci. U.S.A. 104:16086-16091(2007) Crystal structure of human epidermal kallikrein 7 (hK7) synthesized directly in its native state in E. coli insights into the atomic basis of its inhibition by LEKTI domain 6 (LD6) .Fernandez I.S., Standker L., Magert H.J., Forssmann W.G., Gimenez-Gallego G., Romero A.J. Mol. Biol. 377:1488-1497(2008)

NCBI and Uniprot Product Information

• NCBI GI #: 333609286
• NCBI GeneID: 5650
• NCBI Accession #: NP_001193982.1
• NCBI GenBank Nucleotide #: NM_001207053.1
• UniProt Accession #: P49862; Q8N5N9; Q8NFV7; A8K0U5
• Molecular Weight: 26.7 kDa
• NCBI Official Full Name: kallikrein-7 isoform 2
• NCBI Official Synonym Full Names: kallikrein related peptidase 7
• NCBI Official Symbol: KLK7
• NCBI Official Synonym Symbols: hK7; SCCE; PRSS6
• NCBI Protein Information: kallikrein-7
• UniProt Protein Name: Kallikrein-7
• Protein Family: Kallikrein
• UniProt Gene Name: KLK7
• UniProt Synonym Gene Names: PRSS6; SCCE; hK7; hSCCE
• UniProt Entry Name: KLK7_HUMAN

NCBI Description

This gene encodes a member of the kallikrein subfamily of serine proteases. These enzymes have diverse physiological functions and many kallikrein genes are biomarkers for cancer. The encoded protein has chymotrypsin-like activity and plays a role in the proteolysis of intercellular cohesive structures that precedes desquamation, the shedding of the outermost layer of the epidermis. The encoded protein may play a role in cancer invasion and metastasis, and increased expression of this gene is associated with unfavorable prognosis and progression of several types of cancer. Polymorphisms in this gene may play a role in the development of atopic dermatitis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, which is one of fifteen kallikrein subfamily members located in a gene cluster on chromosome 19. [provided by RefSeq, May 2011]

Uniprot Description

KLK7: May catalyze the degradation of intercellular cohesive structures in the cornified layer of the skin in the continuous shedding of cells from the skin surface. Specific for amino acid residues with aromatic side chains in the P1 position. SCCE cleaves insulin B chain at '6-Leu-|-Cys-7', '16-Tyr-|-Leu-17', '25-Phe-|-Tyr-26' and '26-Tyr-|-Thr-27'. Could play a role in the activation of precursors to inflammatory cytokines. Belongs to the peptidase S1 family. Kallikrein subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Protease; EC 3.4.21.35; Secreted

Chromosomal Location of Human Ortholog: 19q13.41

Cellular Component: extracellular region; extracellular space

Molecular Function: peptidase activity; serine-type endopeptidase activity; serine-type peptidase activity

Biological Process: epidermis development; extracellular matrix disassembly; extracellular matrix organization and biogenesis; positive regulation of antibacterial peptide production; proteolysis