Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of KLK7 expression in transfected 293T cell line by KLK7 polyclonal antibody. Lane 1: KLK7 transfected lysate (27.5kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human KLK7 Polyclonal Antibody | anti-KLK7 antibody

KLK7 (Kallikrein-7, hK7, Serine Protease 6, Stratum Corneum Chymotryptic Enzyme, hSCCE, PRSS6, SCCE) APC

Gene Names
KLK7; hK7; SCCE; PRSS6
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KLK7; Polyclonal Antibody; KLK7 (Kallikrein-7; hK7; Serine Protease 6; Stratum Corneum Chymotryptic Enzyme; hSCCE; PRSS6; SCCE) APC; anti-KLK7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human KLK7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-KLK7 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human KLK7, aa1-253 (NP_005037.1).
Immunogen Sequence
MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of KLK7 expression in transfected 293T cell line by KLK7 polyclonal antibody. Lane 1: KLK7 transfected lysate (27.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of KLK7 expression in transfected 293T cell line by KLK7 polyclonal antibody. Lane 1: KLK7 transfected lysate (27.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-KLK7 antibody
May catalyze the degradation of intercellular cohesive structures in the cornified layer of the skin in the continuous shedding of cells from the skin surface. Specific for amino acid residues with aromatic side chains in the P1 position. SCCE cleaves insulin B chain at '6-Leu--Cys-7', '16-Tyr--Leu-17', '25-Phe--Tyr-26' and '26-Tyr--Thr-27'. Could play a role in the activation of precursors to inflammatory cytokines.
Product Categories/Family for anti-KLK7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,887 Da
NCBI Official Full Name
kallikrein-7 isoform 1 preproprotein
NCBI Official Synonym Full Names
kallikrein related peptidase 7
NCBI Official Symbol
KLK7
NCBI Official Synonym Symbols
hK7; SCCE; PRSS6
NCBI Protein Information
kallikrein-7
UniProt Protein Name
Kallikrein-7
Protein Family
UniProt Gene Name
KLK7
UniProt Synonym Gene Names
PRSS6; SCCE; hK7; hSCCE
UniProt Entry Name
KLK7_HUMAN

NCBI Description

This gene encodes a member of the kallikrein subfamily of serine proteases. These enzymes have diverse physiological functions and many kallikrein genes are biomarkers for cancer. The encoded protein has chymotrypsin-like activity and plays a role in the proteolysis of intercellular cohesive structures that precedes desquamation, the shedding of the outermost layer of the epidermis. The encoded protein may play a role in cancer invasion and metastasis, and increased expression of this gene is associated with unfavorable prognosis and progression of several types of cancer. Polymorphisms in this gene may play a role in the development of atopic dermatitis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, which is one of fifteen kallikrein subfamily members located in a gene cluster on chromosome 19. [provided by RefSeq, May 2011]

Uniprot Description

KLK7: May catalyze the degradation of intercellular cohesive structures in the cornified layer of the skin in the continuous shedding of cells from the skin surface. Specific for amino acid residues with aromatic side chains in the P1 position. SCCE cleaves insulin B chain at '6-Leu-|-Cys-7', '16-Tyr-|-Leu-17', '25-Phe-|-Tyr-26' and '26-Tyr-|-Thr-27'. Could play a role in the activation of precursors to inflammatory cytokines. Belongs to the peptidase S1 family. Kallikrein subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.21.35; Protease; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 19q13.41

Cellular Component: extracellular region

Molecular Function: serine-type peptidase activity; serine-type endopeptidase activity

Biological Process: extracellular matrix disassembly; extracellular matrix organization and biogenesis; epidermis development; proteolysis

Research Articles on KLK7

Similar Products

Product Notes

The KLK7 klk7 (Catalog #AAA6383741) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLK7 (Kallikrein-7, hK7, Serine Protease 6, Stratum Corneum Chymotryptic Enzyme, hSCCE, PRSS6, SCCE) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KLK7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KLK7 klk7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KLK7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.