Zinc finger protein 93 (ZNF93) Recombinant Protein | ZNF93 recombinant protein
Recombinant Human Zinc finger protein 93 (ZNF93)
Gene Names
ZNF93; TF34; HPF34; HTF34; ZNF505
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Zinc finger protein 93 (ZNF93); Recombinant Human Zinc finger protein 93 (ZNF93); ZNF93 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-620, Full length protein
Sequence
MGPLQFRDVAIEFSLEEWHCLDTAQRNLYRNVMLENYSNLVFLGIVVSKPDLIAHLEQGKKPLTMKRHEMVANPSVICSHFAQDLWPEQNIKDSFQKVILRRYEKRGHGNLQLIKRCESVDECKVHTGGYNGLNQCSTTTQSKVFQCDKYGKVFHKFSNSNRHNIRHTEKKPFKCIECGKAFNQFSTLITHKKIHTGEKPYICEECGKAFKYSSALNTHKRIHTGEKPYKCDKCDKAFIASSTLSKHEIIHTGKKPYKCEECGKAFNQSSTLTKHKKIHTGEKPYKCEECGKAFNQSSTLTKHKKIHTGEKPYVCEECGKAFKYSRILTTHKRIHTGEKPYKCNKCGKAFIASSTLSRHEFIHMGKKHYKCEECGKAFIWSSVLTRHKRVHTGEKPYKCEECGKAFKYSSTLSSHKRSHTGEKPYKCEECGKAFVASSTLSKHEIIHTGKKPYKCEECGKAFNQSSSLTKHKKIHTGEKPYKCEECGKAFNQSSSLTKHKKIHTGEKPYKCEECGKAFNQSSTLIKHKKIHTREKPYKCEECGKAFHLSTHLTTHKILHTGEKPYRCRECGKAFNHSATLSSHKKIHSGEKPYECDKCGKAFISPSSLSRHEIIHTGEKP
Sequence Length
620
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
61,323 Da
NCBI Official Full Name
zinc finger protein 93
NCBI Official Synonym Full Names
zinc finger protein 93
NCBI Official Symbol
ZNF93
NCBI Official Synonym Symbols
TF34; HPF34; HTF34; ZNF505
NCBI Protein Information
zinc finger protein 93
UniProt Protein Name
Zinc finger protein 93
Protein Family
UniProt Gene Name
ZNF93
UniProt Synonym Gene Names
ZNF505
Uniprot Description
Transcription factor specifically required to repress long interspersed nuclear element 1 (L1) retrotransposons: recognizes and binds L1 sequences and repress their expression by recruiting a repressive complex containing TRIM28/KAP1 (PubMed:25274305). Not able to repress expression of all subtypes of L1 elements. Binds to the 5' end of L1PA4, L1PA5 and L1PA6 subtypes, and some L1PA3 subtypes. Does not bind to L1PA7 or older subtypes nor at the most recently evolved L1PA2 and L1Hs. 50% of L1PA3 elements have lost the ZNF93-binding site, explaining why ZNF93 is not able to repress their expression (PubMed:25274305).
Research Articles on ZNF93
Similar Products
Product Notes
The ZNF93 znf93 (Catalog #AAA952311) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-620, Full length protein. The amino acid sequence is listed below: MGPLQFRDVA IEFSLEEWHC LDTAQRNLYR NVMLENYSNL VFLGIVVSKP DLIAHLEQGK KPLTMKRHEM VANPSVICSH FAQDLWPEQN IKDSFQKVIL RRYEKRGHGN LQLIKRCESV DECKVHTGGY NGLNQCSTTT QSKVFQCDKY GKVFHKFSNS NRHNIRHTEK KPFKCIECGK AFNQFSTLIT HKKIHTGEKP YICEECGKAF KYSSALNTHK RIHTGEKPYK CDKCDKAFIA SSTLSKHEII HTGKKPYKCE ECGKAFNQSS TLTKHKKIHT GEKPYKCEEC GKAFNQSSTL TKHKKIHTGE KPYVCEECGK AFKYSRILTT HKRIHTGEKP YKCNKCGKAF IASSTLSRHE FIHMGKKHYK CEECGKAFIW SSVLTRHKRV HTGEKPYKCE ECGKAFKYSS TLSSHKRSHT GEKPYKCEEC GKAFVASSTL SKHEIIHTGK KPYKCEECGK AFNQSSSLTK HKKIHTGEKP YKCEECGKAF NQSSSLTKHK KIHTGEKPYK CEECGKAFNQ SSTLIKHKKI HTREKPYKCE ECGKAFHLST HLTTHKILHT GEKPYRCREC GKAFNHSATL SSHKKIHSGE KPYECDKCGK AFISPSSLSR HEIIHTGEKP. It is sometimes possible for the material contained within the vial of "Zinc finger protein 93 (ZNF93), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
