Cell division control protein 42 homolog (CDC42) Recombinant Protein | CDC42 recombinant protein

Recombinant Dog Cell division control protein 42 homolog (CDC42)

Cat. Num. AAA952254

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Cell division control protein 42 homolog (CDC42); Recombinant Dog Cell division control protein 42 homolog (CDC42); CDC42 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-188, Full length protein
• Sequence: MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRC
• Sequence Length: 188

• Species: Canis familiaris (Dog) (Canis lupus familiaris)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for CDC42 recombinant protein

This protein is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2
3 complex. Alternative splicing of this gene results in multiple transcript variants.

NCBI and Uniprot Product Information

• NCBI GI #: 55742784
• NCBI GeneID: 403934
• NCBI Accession #: NP_001003254.1
• NCBI GenBank Nucleotide #: NM_001003254.2
• UniProt Accession #: P60952; P21181; P25763
• Molecular Weight: 21,311 Da
• NCBI Official Full Name: cell division control protein 42 homolog
• NCBI Official Symbol: CDC42
• NCBI Protein Information: cell division control protein 42 homolog
• UniProt Protein Name: Cell division control protein 42 homolog
• Protein Family: Cdc42
• UniProt Gene Name: CDC42

Uniprot Description

Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses. Involved in epithelial cell polarization processes. Regulates the bipolar attachment of spindle microtubules to kinetochores before chromosome congression in metaphase. Plays a role in the extension and maintenance of the formation of thin, actin-rich surface projections called filopodia. Mediates CDC42-dependent cell migration. Required for DOCK10-mediated spine formation in Purkinje cells and hippocampal neurons. Facilitates filopodia formation upon DOCK11-activation. Also plays a role in phagocytosis through organization of the F-actin cytoskeleton associated with forming phagocytic cups.