Protransforming growth factor alpha Recombinant Protein | TGFA recombinant protein
Recombinant sheep Protransforming growth factor alpha
Gene Names
TGF-A; TGFA
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Protransforming growth factor alpha; Recombinant sheep Protransforming growth factor alpha; EGF-like TGF; ETGFTGF type 1; TGFA recombinant protein
Host
E Coli
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Tris-based buffer50% glycero
Sequence Positions
Full Length of Extracellular, 24-97aa
Sequence
ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLLQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQ
Application Notes
Optimal dilutions to be determined by the researcher
Immunogen Description
Expression Region 24-97aa; Sequence Info:Extracellular Domain
Tag Info
N-terminal GST-tagged
Calculated MW
34.9 kDa
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability
of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C, -80°C. The shelf life of lyophilized form is 12 monthsat -20°C,-80°C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Generally, the shelf life of liquid form is 6 months at -20°C, -80°C. The shelf life of lyophilized form is 12 monthsat -20°C,-80°C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Protransforming growth factor alpha
NCBI Official Symbol
TGF-A
NCBI Official Synonym Symbols
TGFA
NCBI Protein Information
transforming growth factor alpha
UniProt Protein Name
Protransforming growth factor alpha
Protein Family
UniProt Gene Name
TGFA
UniProt Synonym Gene Names
TGF-A; TGF-alpha; ETGF
Uniprot Description
TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.
Similar Products
Product Notes
The TGFA tgfa (Catalog #AAA9420735) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Full Length of Extracellular, 24-97aa. Optimal dilutions to be determined by the researcher. Researchers should empirically determine the suitability of the TGFA tgfa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ENSTSALSDP PVAAAVVSHF NDCPDSHTQF CFHGTCRFLL QEEKPACVCH SGYVGARCEH ADLLAVVAAS QKKQ. It is sometimes possible for the material contained within the vial of "Protransforming growth factor alpha, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
