Mouse anti-Human RAB21 Monoclonal Antibody | anti-RAB21 antibody

RAB21 (Ras-related Protein Rab-21, KIAA0118) (AP)

Cat. Num. AAA6133253

• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RAB21; Monoclonal Antibody; RAB21 (Ras-related Protein Rab-21; KIAA0118) (AP); anti-RAB21 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1F6
• Specificity: Recognizes human RAB21.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 15558

• Applicable Applications for anti-RAB21 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa116-226 from RAB21 (NP_055814) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCCSSG*
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(RAB21 monoclonal antibody Western Blot analysis of RAB21 expression in HeLa)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RAB21 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RAB21 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged RAB21 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-RAB21 antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 1519314256
• NCBI GeneID: 23011
• NCBI Accession #: NM_014999.4
• NCBI GenBank Nucleotide #: NM_014999
• NCBI Official Full Name: Homo sapiens RAB21, member RAS oncogene family (RAB21), mRNA
• NCBI Official Synonym Full Names: RAB21, member RAS oncogene family
• NCBI Official Symbol: RAB21
• NCBI Protein Information: ras-related protein Rab-21
• Protein Family: Ras-related protein

NCBI Description

This gene belongs to the Rab family of monomeric GTPases, which are involved in the control of cellular membrane traffic. The encoded protein plays a role in the targeted trafficking of integrins via its association with integrin alpha tails. As a consequence, the encoded protein is involved in the regulation of cell adhesion and migration. Expression of this gene is associated with a poor prognosis for glioma patients. This gene is downregulated by the tumor suppressor miR-200b, and miRNA-200b is itself downregulated in glioma tissues. [provided by RefSeq, Nov 2015]