Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Serum paraoxonase/arylesterase 1 Recombinant Protein | PON1 recombinant protein

Recombinant Human Serum paraoxonase/arylesterase 1

Gene Names
PON1; ESA; PON; MVCD5
Reactivity
Human
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Serum paraoxonase/arylesterase 1; Recombinant Human Serum paraoxonase/arylesterase 1; Aromatic esterase 1; A-esterase 1K-45Serum aryldialkylphosphatase 1; PON1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Reactivity
Human
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
20mM Tris-HCl based buffer, pH8.0
Sequence Positions
Full Length, 2-355aa
Tag Info
GST-tag
Target Name
PON1
Calculated MW
67 kD
Target Sequence
AKLIALTLLGMGLALFRNHQSSYQTRLNALREVQPVELPNCNLVKGIETGSEDLEILPNGLAFISSGLKYPGIKSFNPNSPGKILLMDLNEED
PTVLELGITGSKFDVSSFNPHGISTFTDEDNAMYLLVVNHPDAKSTVELFKFQEEEKSLLHLKTIRHKLLPNLNDIVAVGPEHFYGTNDHYFL
DPYLQSWEMYLGLAWSYVVYYSPSEVRVVAEGFDFANGNISPDGKYVYIAELLAHKIHVYEKHANWTLTPLKSLDFNTLVDNISVDPET
GDLWVGCHPNGMKIFFYDSENPPASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKALYCEL
Preparation and Storage
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Repeated freezing and thawing is not recommended.
Store working aliquots at 4°C for up to one week.
Related Product Information for PON1 recombinant protein
Recombinant Protein

Hydrolyzes the toxic metabolites of a variety of organophosphorus insecticides. Capable of hydrolyzing a broad spectrum of organophosphate substrates and lactones, and a number of aromatic carboxylic acid esters. Mediates an enzymatic protection of low density lipoproteins against oxidative modification and the consequent series of events leading to atheroma formation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
serum paraoxonase/arylesterase 1
NCBI Official Synonym Full Names
paraoxonase 1
NCBI Official Symbol
PON1
NCBI Official Synonym Symbols
ESA; PON; MVCD5
NCBI Protein Information
serum paraoxonase/arylesterase 1
UniProt Protein Name
Serum paraoxonase/arylesterase 1
UniProt Gene Name
PON1
UniProt Synonym Gene Names
PON; A-esterase 1

NCBI Description

The enzyme encoded by this gene is an arylesterase that mainly hydrolyzes paroxon to produce p-nitrophenol. Paroxon is an organophosphorus anticholinesterase compound that is produced in vivo by oxidation of the insecticide parathion. Polymorphisms in this gene are a risk factor in coronary artery disease. The gene is found in a cluster of three related paraoxonase genes at 7q21.3. [provided by RefSeq, Oct 2008]

Uniprot Description

PON1: Hydrolyzes the toxic metabolites of a variety of organophosphorus insecticides. Capable of hydrolyzing a broad spectrum of organophosphate substrates and lactones, and a number of aromatic carboxylic acid esters. Mediates an enzymatic protection of low density lipoproteins against oxidative modification and the consequent series of events leading to atheroma formation. Genetic variation in PON1 is associated with susceptibility to microvascular complications of diabetes type 5 (MVCD5). These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new- onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. Homozygosity for the Leu-54 allele is strongly associated with the development of retinal disease in diabetic patients. Belongs to the paraoxonase family.

Protein type: EC 3.1.1.2; EC 3.1.1.81; EC 3.1.8.1; Hydrolase; Lipid-binding; Motility/polarity/chemotaxis; Phosphatase (non-protein); Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 7q21.3

Cellular Component: extracellular region; extracellular space

Molecular Function: aryldialkylphosphatase activity; arylesterase activity; calcium ion binding; phospholipid binding; protein homodimerization activity

Biological Process: aromatic compound catabolic process; carboxylic acid catabolic process; lipoxygenase pathway; organophosphate catabolic process; phosphatidylcholine metabolic process; positive regulation of binding; positive regulation of transporter activity; response to toxin

Disease: Microvascular Complications Of Diabetes, Susceptibility To, 5

Research Articles on PON1

Similar Products

Product Notes

The PON1 pon1 (Catalog #AAA9420554) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Full Length, 2-355aa. The Recombinant Human Serum paraoxonase/arylesterase 1 reacts with Human and may cross-react with other species as described in the data sheet. It is sometimes possible for the material contained within the vial of "Serum paraoxonase/arylesterase 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.