Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of SH-SY5Y cells, using THSD4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Rabbit anti-Human, Mouse THSD4 Polyclonal Antibody | anti-THSD4 antibody

THSD4 Rabbit pAb

Gene Names
THSD4; ADAMTSL6; FVSY9334; PRO34005; ADAMTSL-6
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
THSD4; Polyclonal Antibody; THSD4 Rabbit pAb; ADAMTSL-6; ADAMTSL6; FVSY9334; PRO34005; anti-THSD4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
AEGPTNEILDVYMIHQQPNPGVHYEYVIMGTNAISPQVPPHRRPGEPFNGQMVTEGRSQEEGEQKGRNEEKEDLRGEAPEMFTSESAQTFPVRHPDRFSPHRPDNLVPPAPQPPRRSRDHNWKQLGTTECSTTCGKGSQYPIFRCVHRSTHEEAPESYCDSSMKPTPEEEPCNIFPCPAFWDIGEWSECSKTCGLGMQHRQ
Applicable Applications for anti-THSD4 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 500-700 of human THSD4 (NP_079093.2).
Positive Samples
SH-SY5Y
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of SH-SY5Y cells, using THSD4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of SH-SY5Y cells, using THSD4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
112,450 Da
NCBI Official Full Name
thrombospondin type-1 domain-containing protein 4 isoform 2
NCBI Official Synonym Full Names
thrombospondin, type I, domain containing 4
NCBI Official Symbol
THSD4
NCBI Official Synonym Symbols
ADAMTSL6; FVSY9334; PRO34005; ADAMTSL-6
NCBI Protein Information
thrombospondin type-1 domain-containing protein 4; ADAMTS-like protein 6; A disintegrin and metalloproteinase with thrombospondin motifs-like protein 6
UniProt Protein Name
Thrombospondin type-1 domain-containing protein 4
UniProt Gene Name
THSD4
UniProt Synonym Gene Names
UNQ9334/PRO34005; ADAMTS-like protein 6; ADAMTSL-6
UniProt Entry Name
THSD4_HUMAN

Uniprot Description

THSD4: Promotes FBN1 matrix assembly. Attenuates TGFB signaling, possibly by accelerating the sequestration of large latent complexes of TGFB or active TGFB by FBN1 microfibril assembly, thereby negatively regulating the expression of TGFB regulatory targets, such as POSTN. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Extracellular matrix; Secreted; Protease; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 15q23

Cellular Component: microfibril

Molecular Function: metalloendopeptidase activity

Biological Process: elastic fiber assembly; proteolysis

Research Articles on THSD4

Similar Products

Product Notes

The THSD4 thsd4 (Catalog #AAA9143007) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The THSD4 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's THSD4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the THSD4 thsd4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AEGPTNEILD VYMIHQQPNP GVHYEYVIMG TNAISPQVPP HRRPGEPFNG QMVTEGRSQE EGEQKGRNEE KEDLRGEAPE MFTSESAQTF PVRHPDRFSP HRPDNLVPPA PQPPRRSRDH NWKQLGTTEC STTCGKGSQY PIFRCVHRST HEEAPESYCD SSMKPTPEEE PCNIFPCPAF WDIGEWSECS KTCGLGMQHR Q. It is sometimes possible for the material contained within the vial of "THSD4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.