Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using TBC1D5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Rabbit anti-Human, Rat TBC1D5 Polyclonal Antibody | anti-TBC1D5 antibody
TBC1D5 Rabbit pAb
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
TBC1D5; Polyclonal Antibody; TBC1D5 Rabbit pAb; anti-TBC1D5 antibody
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
NAKGAPLNINKVSNSLINFGRKLISPAMAPGSAGGPVPGGNSSSSSSVVIPTRTSAEAPSHHLQQQQQQQRLMKSESMPVQLNKGLSSKNISSSPSVESLPGGREFTGSPPSSATKKDSFFSNISRSRSHSKTMGRKESEEELEAQISFLQGQLNDLDAMCKYCAKVMDTHLVNIQDVILQENLEKEDQILVSLAGLKQIKDILKGSLRFNQSQLEAEENEQITIADNHYCSSGQGQGRGQGQSVQMSGAIKQASSETPGCTDRGNSDDFILISKDDDGSSARGSFSGQAQPLRTLRSTSGKSQAPVCSPLVFSDPLMGPASASSSNPSSSPDDDSSKDSGFTIVSPLDI
Applicable Applications for anti-TBC1D5 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 446-795 of human TBC1D5 (NP_055559.1).
Positive Samples
A-431, HeLa, U-251MG, Rat lung
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using TBC1D5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using TBC1D5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
89,004 Da
NCBI Official Full Name
TBC1 domain family member 5 isoform a
NCBI Official Synonym Full Names
TBC1 domain family, member 5
NCBI Official Symbol
TBC1D5
NCBI Protein Information
TBC1 domain family member 5
UniProt Protein Name
TBC1 domain family member 5
Protein Family
UniProt Gene Name
TBC1D5
UniProt Synonym Gene Names
KIAA0210
UniProt Entry Name
TBCD5_HUMAN
Similar Products
Product Notes
The TBC1D5 tbc1d5 (Catalog #AAA9142599) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TBC1D5 Rabbit pAb reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TBC1D5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the TBC1D5 tbc1d5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NAKGAPLNIN KVSNSLINFG RKLISPAMAP GSAGGPVPGG NSSSSSSVVI PTRTSAEAPS HHLQQQQQQQ RLMKSESMPV QLNKGLSSKN ISSSPSVESL PGGREFTGSP PSSATKKDSF FSNISRSRSH SKTMGRKESE EELEAQISFL QGQLNDLDAM CKYCAKVMDT HLVNIQDVIL QENLEKEDQI LVSLAGLKQI KDILKGSLRF NQSQLEAEEN EQITIADNHY CSSGQGQGRG QGQSVQMSGA IKQASSETPG CTDRGNSDDF ILISKDDDGS SARGSFSGQA QPLRTLRSTS GKSQAPVCSP LVFSDPLMGP ASASSSNPSS SPDDDSSKDS GFTIVSPLDI. It is sometimes possible for the material contained within the vial of "TBC1D5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
