Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using BOK antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)

Rabbit BOK Polyclonal Antibody | anti-BOK antibody

BOK Rabbit pAb

Gene Names
BOK; BOKL; BCL2L9
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity purification
Synonyms
BOK; Polyclonal Antibody; BOK Rabbit pAb; BCL2L9; BOKL; anti-BOK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVPGRLAEVCAVLLRLGDELEMIRPSVYRNVARQLHISLQSEP
Applicable Applications for anti-BOK antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human BOK (NP_115904.1).
Cellular Location
Endoplasmic reticulum membrane, Golgi apparatus membrane, Single-pass membrane protein
Positive Samples
Mouse brain, Rat testis
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using BOK antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using BOK antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded mouse spleen using BOK Rabbit pAb at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded mouse spleen using BOK Rabbit pAb at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded rat lung using BOK Rabbit pAb at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded rat lung using BOK Rabbit pAb at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded rat ovary using BOK Rabbit pAb at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded rat ovary using BOK Rabbit pAb at dilution of 1:100 (40x lens).)

Immunofluorescence (IF)

(Immunofluorescence analysis of MCF7 cells using BOK Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence analysis of MCF7 cells using BOK Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Immunofluorescence (IF)

(Immunofluorescence analysis of NIH/3T3 cells using BOK Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence analysis of NIH/3T3 cells using BOK Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)
Related Product Information for anti-BOK antibody
Background: The protein encoded by this gene belongs to the BCL2 family, members of which form homo- or heterodimers, and act as anti- or proapoptotic regulators that are involved in a wide variety of cellular processes. Studies in rat show that this protein has restricted expression in reproductive tissues, interacts strongly with some antiapoptotic BCL2 proteins, not at all with proapoptotic BCL2 proteins, and induces apoptosis in transfected cells. Thus, this protein represents a proapoptotic member of the BCL2 family.
Product Categories/Family for anti-BOK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
666
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,280 Da
NCBI Official Full Name
bcl-2-related ovarian killer protein
NCBI Official Synonym Full Names
BCL2-related ovarian killer
NCBI Official Symbol
BOK
NCBI Official Synonym Symbols
BOKL; BCL2L9
NCBI Protein Information
bcl-2-related ovarian killer protein; hBOK; bcl2-L-9; bcl-2-like protein 9
UniProt Protein Name
Bcl-2-related ovarian killer protein
UniProt Gene Name
BOK
UniProt Synonym Gene Names
BCL2L9; hBOK; Bcl2-L-9
UniProt Entry Name
BOK_HUMAN

NCBI Description

The protein encoded by this gene belongs to the BCL2 family, members of which form homo- or heterodimers, and act as anti- or proapoptotic regulators that are involved in a wide variety of cellular processes. Studies in rat show that this protein has restricted expression in reproductive tissues, interacts strongly with some antiapoptotic BCL2 proteins, not at all with proapoptotic BCL2 proteins, and induces apoptosis in transfected cells. Thus, this protein represents a proapoptotic member of the BCL2 family. [provided by RefSeq, Sep 2011]

Uniprot Description

BOK: May play a role in apoptosis. Belongs to the Bcl-2 family.

Chromosomal Location of Human Ortholog: 2q37.3

Cellular Component: Golgi membrane; endoplasmic reticulum membrane; mitochondrial outer membrane; mitochondrion; mitochondrial membrane; cytoplasm; integral to membrane; nucleus

Molecular Function: BH domain binding; protein binding; protein homodimerization activity; protein heterodimerization activity

Biological Process: caspase activation; cell proliferation; neuron apoptosis; DNA damage response, signal transduction resulting in induction of apoptosis; apoptosis; male gonad development; oligodendrocyte differentiation; brain development

Research Articles on BOK

Similar Products

Product Notes

The BOK bok (Catalog #AAA9142284) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BOK Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BOK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500-1:2000 IHC: 1:50-1:200. Researchers should empirically determine the suitability of the BOK bok for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEVLRRSSVF AAEIMDAFDR SPTDKELVAQ AKALGREYVH ARLLRAGLSW SAPERAAPVP GRLAEVCAVL LRLGDELEMI RPSVYRNVAR QLHISLQSEP. It is sometimes possible for the material contained within the vial of "BOK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.