Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-GPR37 Polyclonal Antibody)

Rabbit anti-Human, Rat GPR37 Polyclonal Antibody | anti-GPR37 antibody

GPR37 Polyclonal Antibody

Gene Names
GPR37; PAELR; EDNRBL; hET(B)R-LP
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
GPR37; Polyclonal Antibody; GPR37 Polyclonal Antibody; EDNRBL; PAELR; hET(B)R-LP; prosaposin receptor GPR37; anti-GPR37 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.76 mg/ml (varies by lot)
Sequence Length
613
Applicable Applications for anti-GPR37 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 40-180 of human GPR37 (NP_005293.1).
Immunogen Sequence
LGESCAPTVIQRRGRDAWGPGNSARDVLRARAPREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPWRWKGARGQEPSETLGRGNPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLF
Positive Samples
U-87MG, U-251MG
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-GPR37 Polyclonal Antibody)

Western Blot (WB) (Western blot-GPR37 Polyclonal Antibody)
Related Product Information for anti-GPR37 antibody
This gene is a member of the G protein-coupled receptor family. The encoded protein contains seven transmembrane domains and is found in cell and endoplasmic reticulum membranes. G protein-coupled receptors are involved in translating outside signals into G protein mediated intracellular effects. This gene product interacts with Parkin and is involved in juvenile Parkinson disease.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 67kDa
Observed: 67kDa
NCBI Official Full Name
prosaposin receptor GPR37
NCBI Official Synonym Full Names
G protein-coupled receptor 37
NCBI Official Symbol
GPR37
NCBI Official Synonym Symbols
PAELR; EDNRBL; hET(B)R-LP
NCBI Protein Information
prosaposin receptor GPR37
UniProt Protein Name
Probable G-protein coupled receptor 37
Protein Family
UniProt Gene Name
GPR37
UniProt Synonym Gene Names
ETBR-LP-1; PAELR
UniProt Entry Name
GPR37_HUMAN

NCBI Description

This gene is a member of the G protein-coupled receptor family. The encoded protein contains seven transmembrane domains and is found in cell and endoplasmic reticulum membranes. G protein-coupled receptors are involved in translating outside signals into G protein mediated intracellular effects. This gene product interacts with Parkin and is involved in juvenile Parkinson disease. [provided by RefSeq, Oct 2012]

Uniprot Description

GPR37: Orphan receptor. May have a unique functional role in the central nervous system. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR; GPCR, family 1

Chromosomal Location of Human Ortholog: 7q31

Cellular Component: endoplasmic reticulum membrane; integral to plasma membrane; plasma membrane; ubiquitin ligase complex; receptor complex

Molecular Function: G-protein coupled receptor activity; protein binding; ubiquitin protein ligase binding; heat shock protein binding; peptide receptor activity, G-protein coupled; Hsp70 protein binding; peptide binding

Biological Process: positive regulation of dopamine metabolic process; G-protein coupled receptor protein signaling pathway; positive regulation of MAPKKK cascade; G-protein signaling, adenylate cyclase inhibiting pathway; dopamine biosynthetic process; locomotion during locomotory behavior

Research Articles on GPR37

Similar Products

Product Notes

The GPR37 gpr37 (Catalog #AAA9140977) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPR37 Polyclonal Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GPR37 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the GPR37 gpr37 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GPR37, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.