Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-IGFBP3 Polyclonal Antibody)

Rabbit anti-Human, Mouse IGFBP3 Polyclonal Antibody | anti-IGFBP3 antibody

IGFBP3 Polyclonal Antibody

Gene Names
IGFBP3; IBP3; BP-53
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
IGFBP3; Polyclonal Antibody; IGFBP3 Polyclonal Antibody; BP-53; IBP3; insulin-like growth factor-binding protein 3; anti-IGFBP3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.72 mg/ml (varies by lot)
Sequence Length
291
Applicable Applications for anti-IGFBP3 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human IGFBP3 (NP_000589.2).
Immunogen Sequence
EARPLQALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNF
Positive Samples
LO2, A-431, HeLa, Mouse Liver
Cellular Location
Secreted
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-IGFBP3 Polyclonal Antibody)

Western Blot (WB) (Western blot-IGFBP3 Polyclonal Antibody)
Related Product Information for anti-IGFBP3 antibody
This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 31kDa; 32kDa
Observed: 32kDa
NCBI Official Full Name
insulin-like growth factor-binding protein 3 isoform b
NCBI Official Synonym Full Names
insulin like growth factor binding protein 3
NCBI Official Symbol
IGFBP3
NCBI Official Synonym Symbols
IBP3; BP-53
NCBI Protein Information
insulin-like growth factor-binding protein 3
UniProt Protein Name
Insulin-like growth factor-binding protein 3
UniProt Gene Name
IGFBP3
UniProt Synonym Gene Names
IBP3; IBP-3; IGF-binding protein 3; IGFBP-3
UniProt Entry Name
IBP3_HUMAN

NCBI Description

This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

IGFBP3: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Also exhibits IGF-independent antiproliferative and apoptotic effects mediated by its receptor TMEM219/IGFBP-3R.

Protein type: Secreted; Cell development/differentiation; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 7p12.3

Cellular Component: insulin-like growth factor binding protein complex; extracellular space; extracellular region; nucleus

Molecular Function: insulin-like growth factor binding; protein binding; insulin-like growth factor I binding; fibronectin binding; metal ion binding; insulin-like growth factor II binding; protein tyrosine phosphatase activator activity

Biological Process: positive regulation of insulin-like growth factor receptor signaling pathway; positive regulation of catalytic activity; regulation of insulin-like growth factor receptor signaling pathway; apoptosis; positive regulation of apoptosis; negative regulation of smooth muscle cell proliferation; negative regulation of smooth muscle cell migration; protein amino acid phosphorylation; positive regulation of myoblast differentiation; negative regulation of signal transduction; osteoblast differentiation; negative regulation of cell proliferation; cellular protein metabolic process; negative regulation of protein amino acid phosphorylation; positive regulation of MAPKKK cascade; regulation of cell growth

Research Articles on IGFBP3

Similar Products

Product Notes

The IGFBP3 igfbp3 (Catalog #AAA9140691) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IGFBP3 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's IGFBP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the IGFBP3 igfbp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IGFBP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.