Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-UCKL1 Polyclonal Antibody)

Rabbit anti-Mouse, Rat UCKL1 Polyclonal Antibody | anti-UCKL1 antibody

UCKL1 Polyclonal Antibody

Gene Names
UCKL1; UCK1L; URKL1
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
UCKL1; Polyclonal Antibody; UCKL1 Polyclonal Antibody; UCK1L; URKL1; uridine-cytidine kinase-like 1; anti-UCKL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.06 mg/ml (varies by lot)
Sequence Length
548
Applicable Applications for anti-UCKL1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human UCKL1 (NP_060329.2).
Immunogen Sequence
MAAPPARADADPSPTSPPTARDTPGRQAEKSETACEDRSNAESLDRLLPPVGTGRSPRKRTTSQCKSEPPLLRTSKRTIYTAGRPPWYNEHGTQSKEAFAIGLGGGSASGKTTVARMIIEALDVPWVVLLSMDSFYKVLTEQQQEQAAHNNFNFDHPDAFDFDLIISTLKKLKQGKSVKVPIYDFTTHSRKKDWKTLYGA
Positive Samples
Mouse Heart, Mouse Lung, Rat Pancreas
Cellular Location
Cytoplasm, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-UCKL1 Polyclonal Antibody)

Western Blot (WB) (Western blot-UCKL1 Polyclonal Antibody)
Related Product Information for anti-UCKL1 antibody
The protein encoded by this gene is a uridine kinase. Uridine kinases catalyze the phosphorylation of uridine to uridine monophosphate. This protein has been shown to bind to Epstein-Barr nuclear antigen 3 as well as natural killer lytic-associated molecule. Ubiquitination of this protein is enhanced by the presence of natural killer lytic-associated molecule. In addition, protein levels decrease in the presence of natural killer lytic-associated molecule, suggesting that association with natural killer lytic-associated molecule results in ubiquitination and subsequent degradation of this protein. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated: 44kDa; 45kDa; 59kDa; 61kDa
Observed: 61kDa
NCBI Official Full Name
Uridine-cytidine kinase-like 1
NCBI Official Synonym Full Names
uridine-cytidine kinase 1 like 1
NCBI Official Symbol
UCKL1
NCBI Official Synonym Symbols
UCK1L; URKL1
NCBI Protein Information
uridine-cytidine kinase-like 1
UniProt Protein Name
Uridine-cytidine kinase-like 1
Protein Family
UniProt Gene Name
UCKL1
UniProt Synonym Gene Names
URKL1
UniProt Entry Name
UCKL1_HUMAN

NCBI Description

The protein encoded by this gene is a uridine kinase. Uridine kinases catalyze the phosphorylation of uridine to uridine monophosphate. This protein has been shown to bind to Epstein-Barr nuclear antigen 3 as well as natural killer lytic-associated molecule. Ubiquitination of this protein is enhanced by the presence of natural killer lytic-associated molecule. In addition, protein levels decrease in the presence of natural killer lytic-associated molecule, suggesting that association with natural killer lytic-associated molecule results in ubiquitination and subsequent degradation of this protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2014]

Uniprot Description

UCKL1: May contribute to UTP accumulation needed for blast transformation and proliferation. Belongs to the uridine kinase family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.7.1.48; Transferase; Nucleotide Metabolism - pyrimidine; Xenobiotic Metabolism - drug metabolism - other enzymes

Chromosomal Location of Human Ortholog: 20q13.33

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; uridine kinase activity; ATP binding

Biological Process: viral reproduction; phosphorylation

Research Articles on UCKL1

Similar Products

Product Notes

The UCKL1 uckl1 (Catalog #AAA9140559) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UCKL1 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UCKL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the UCKL1 uckl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UCKL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.