Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human Pre-B-Cell Colony-Enhancing Factor 1/PBEF/Visfatin Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

Pre-B-Cell Colony-Enhancing Factor 1/PBEF/Visfatin Recombinant Protein | PBEF recombinant protein

Recombinant Human Pre-B-Cell Colony-Enhancing Factor 1/PBEF/Visfatin Protein

Gene Names
NAMPT; VF; PBEF; PBEF1; VISFATIN; 1110035O14Rik
Purity
>95% by SDS-PAGE.
Synonyms
Pre-B-Cell Colony-Enhancing Factor 1/PBEF/Visfatin; Recombinant Human Pre-B-Cell Colony-Enhancing Factor 1/PBEF/Visfatin Protein; Pre-B cell-enhancing factor; Nicotinamide phosphoribosyltransferase; NAmPRTase; Nampt; Pre-B-cell colony-enhancing factor 1; Visfatin; NAMPT; PBEF; PBEF1; PBEF recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of 20mM HEPES, 150mM NaCl, pH8.0.
Sequence
MNPAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYLKGKVVTKEKIQEAKDVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGK
Sequence Length
491
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the N-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human Pre-B-Cell Colony-Enhancing Factor 1/PBEF/Visfatin Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

SDS-Page (Recombinant Human Pre-B-Cell Colony-Enhancing Factor 1/PBEF/Visfatin Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for PBEF recombinant protein
Description: Recombinant Human Pre-B-Cell Colony-Enhancing Factor 1/PBEF/Visfatin Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-His491) of human Pre-B-Cell Colony-Enhancing Factor 1/PBEF/Visfatin (Accession #P43490) fused with a 6xHis tag at the N-terminus.

Background: Pre-B cell colony enhancing factor (PBEF) was originally identified as a cytokine that potentiated the clonalexpansion and differentiation of pre-B cells, but it is also acknowledged to be the ubiquitous intracellularenzyme nicotinamide phosphoribosyltranferase (NAMPT) and the adipokine " visfatin ". PBEF is constitutivelyexpressed in the fetal membranes where its greatest expression is in the amnion. It has intracellular andextracellular forms. Most of the intracellular functions of PBEF are due to its role as a Nampt which can induceangiogenesis through upregulation of VEGF and VEGFR and secretion of MCP-1. Extracellular PBEF has beenshown to increase inflammatory cytokines, such as TNF- alpha, IL-1 beta, IL-16, and TGF- beta 1. PBEF also increases theproduction of IL-6, TNF- alpha, and IL-1 beta in CD14+ monocyctes, macrophages, and dendritic cells, enhances theeffectiveness of T cells.
Product Categories/Family for PBEF recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Nicotinamide phosphoribosyltransferase
NCBI Official Synonym Full Names
nicotinamide phosphoribosyltransferase
NCBI Official Symbol
NAMPT
NCBI Official Synonym Symbols
VF; PBEF; PBEF1; VISFATIN; 1110035O14Rik
NCBI Protein Information
nicotinamide phosphoribosyltransferase
UniProt Protein Name
Nicotinamide phosphoribosyltransferase
UniProt Gene Name
NAMPT
UniProt Synonym Gene Names
PBEF; PBEF1; NAmPRTase; Nampt; Pre-B cell-enhancing factor
UniProt Entry Name
NAMPT_HUMAN

NCBI Description

This gene encodes a protein that catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The protein belongs to the nicotinic acid phosphoribosyltransferase (NAPRTase) family and is thought to be involved in many important biological processes, including metabolism, stress response and aging. This gene has a pseudogene on chromosome 10. [provided by RefSeq, Feb 2011]

Uniprot Description

PBEF: an ubiquitous protein originally described as a cytokine which acts on early B-lineage precursor cells. Other reports indicate that PBEF is not a cytokine-like secreted protein but an intracellular protein associated with the cell cycle. Contains a catalytically active nicotinate phosphoribosyltransferase domain, an enzyme involved in nicotinamide adenine dinucleotide (NAD) biosynthesis.

Protein type: Cell cycle regulation; Transferase; EC 2.4.2.12; Cytokine; Cofactor and Vitamin Metabolism - nicotinate and nicotinamide

Chromosomal Location of Human Ortholog: 7q22.3

Cellular Component: extracellular space; cytosol; nucleus

Molecular Function: protein binding; protein homodimerization activity; cytokine activity; nicotinate-nucleotide diphosphorylase (carboxylating) activity; drug binding; nicotinamide phosphoribosyltransferase activity

Biological Process: circadian rhythm; vitamin metabolic process; positive regulation of smooth muscle cell proliferation; female pregnancy; signal transduction; response to organic cyclic substance; NAD biosynthetic process; cell-cell signaling; NAD metabolic process; nicotinamide metabolic process; positive regulation of cell proliferation; insulin receptor signaling pathway; positive regulation of transcription from RNA polymerase II promoter; circadian regulation of gene expression; water-soluble vitamin metabolic process; positive regulation of nitric-oxide synthase biosynthetic process

Research Articles on PBEF

Similar Products

Product Notes

The PBEF nampt (Catalog #AAA9140155) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MNPAAEAEFN ILLATDSYKV THYKQYPPNT SKVYSYFECR EKKTENSKLR KVKYEETVFY GLQYILNKYL KGKVVTKEKI QEAKDVYKEH FQDDVFNEKG WNYILEKYDG HLPIEIKAVP EGFVIPRGNV LFTVENTDPE CYWLTNWIET ILVQSWYPIT VATNSREQKK ILAKYLLETS GNLDGLEYKL HDFGYRGVSS QETAGIGASA HLVNFKGTDT VAGLALIKKY YGTKDPVPGY SVPAAEHSTI TAWGK. It is sometimes possible for the material contained within the vial of "Pre-B-Cell Colony-Enhancing Factor 1/PBEF/Visfatin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.