Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant protein Human R-spondin-3/RSPO3 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 70 kDa.)

R-spondin-3/RSPO3 Active Protein | RSPO3 active protein

Recombinant Human R-spondin-3/RSPO3 Protein

Gene Names
RSPO3; PWTSR; THSD2; CRISTIN1
Purity
>95% by SDS-PAGE.
Synonyms
R-spondin-3/RSPO3; Recombinant Human R-spondin-3/RSPO3 Protein; CRISTIN1; PWTSR; THSD2; RSPO3 active protein
Ordering
For Research Use Only!
Host
Human Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of 20 mM PB, 150 mM NaCl, pH7.2.
Sequence
QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH
Sequence Length
272
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its ability to induce Topflash reporter activity in HEK293T human embryonic kidney cells. The ED50 for this effect is 0.5-2.0 ng/mL in the presence of 5 ng/mL Recombinant Mouse Wnt-3a.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
Fc, 6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant protein Human R-spondin-3/RSPO3 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 70 kDa.)

SDS-Page (Recombinant protein Human R-spondin-3/RSPO3 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 70 kDa.)
Related Product Information for RSPO3 active protein
Description: Recombinant Human R-spondin-3/RSPO3 Protein is produced by Human Cell expression system. The target protein is expressed with sequence (Gln22-His272) of human R-spondin-3/RSPO3 (Accession #Q9BXY4) fused with an Fc, 6xHis tag at the C-terminus.

Background: This protein belongs to the R-spondin family. The encoded protein plays a role in the regulation of Wnt (wingless-type MMTV integration site family)/beta-catenin and Wnt/planar cell polarity (PCP) signaling pathways, which are involved in development, cell growth and disease pathogenesis. Genome-wide association studies suggest a correlation of this gene with bone mineral density and risk of fracture. This gene may be involved in tumor development.
Product Categories/Family for RSPO3 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
R-spondin-3
NCBI Official Synonym Full Names
R-spondin 3
NCBI Official Symbol
RSPO3
NCBI Official Synonym Symbols
PWTSR; THSD2; CRISTIN1
NCBI Protein Information
R-spondin-3
UniProt Protein Name
R-spondin-3
Protein Family
UniProt Gene Name
RSPO3
UniProt Synonym Gene Names
PWTSR; THSD2; hPWTSR; hRspo3
UniProt Entry Name
RSPO3_HUMAN

NCBI Description

This gene belongs to the R-spondin family. The encoded protein plays a role in the regulation of Wnt (wingless-type MMTV integration site family)/beta-catenin and Wnt/planar cell polarity (PCP) signaling pathways, which are involved in development, cell growth and disease pathogenesis. Genome-wide association studies suggest a correlation of this gene with bone mineral density and risk of fracture. This gene may be involved in tumor development. [provided by RefSeq, Jul 2013]

Uniprot Description

R-spondin-3: Activator of the beta-catenin signaling cascade, leading to TCF-dependent gene activation. Acts both in the canonical Wnt/beta-catenin-dependent pathway and in non-canonical Wnt signaling pathway, probably by acting as an inhibitor of ZNRF3, an important regulator of the Wnt signaling pathway. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway. Belongs to the R-spondin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 6q22.33

Cellular Component: extracellular space; extracellular region

Molecular Function: heparin binding; G-protein-coupled receptor binding; frizzled binding; receptor binding

Biological Process: Wnt receptor signaling pathway through beta-catenin

Research Articles on RSPO3

Similar Products

Product Notes

The RSPO3 rspo3 (Catalog #AAA9139872) is an Active Protein produced from Human Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: QNASRGRRQR RMHPNVSQGC QGGCATCSDY NGCLSCKPRL FFALERIGMK QIGVCLSSCP SGYYGTRYPD INKCTKCKAD CDTCFNKNFC TKCKSGFYLH LGKCLDNCPE GLEANNHTME CVSIVHCEVS EWNPWSPCTK KGKTCGFKRG TETRVREIIQ HPSAKGNLCP PTNETRKCTV QRKKCQKGER GKKGRERKRK KPNKGESKEA IPDSKSLESS KEIPEQRENK QQQKKRKVQD KQKSVSVSTV H. It is sometimes possible for the material contained within the vial of "R-spondin-3/RSPO3, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.