SDS-Page
(Recombinant protein Human DLL4 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 70 kDa.)
DLL4 active protein
Recombinant Human DLL4 Protein
Gene Names
DLL4; AOS6; delta4; hdelta2
Purity
>95% by SDS-PAGE.
Synonyms
DLL4; Recombinant Human DLL4 Protein; AOS6; hdelta2; DLL4 active protein
Host
Human Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of 20 mM Tris, 150 mM NaCl, pH8.0.
Sequence
SGVFQLQLQEFINERGVLASGRPCEPGCRTFFRVCLKHFQAVVSPGPCTFGTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIEAWHAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPICLSGCHEQNGYCSKPAECLCRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEGWGGLFC
Sequence Length
685
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Biological Activity
Measured by the ability of the immobilized protein to enhance BMP-2 induced alkaline phosphatase activity in C3H10T1/2 mouse embryonic fibroblast cells. The ED50 for this effect is 150-600 ng/mL.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
10xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
SDS-Page
(Recombinant protein Human DLL4 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 70 kDa.)
SDS-Page
(Recombinant protein Human DLL4 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 70 kDa.)
Related Product Information for DLL4 active protein
Description: Recombinant Human DLL4 Protein is produced by Human Cell expression system. The target protein is expressed with sequence (Ser27-Pro524) of human DLL4 (Accession #Q9NR61) fused with a 10xHis tag at the C-terminus.
Background: This protein is a homolog of the Drosophila delta family. The delta family encodes Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain.
Background: This protein is a homolog of the Drosophila delta family. The delta family encodes Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain.
Product Categories/Family for DLL4 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
delta-like protein 4
NCBI Official Synonym Full Names
delta like canonical Notch ligand 4
NCBI Official Symbol
DLL4
NCBI Official Synonym Symbols
AOS6; delta4; hdelta2
NCBI Protein Information
delta-like protein 4
UniProt Protein Name
Delta-like protein 4
Protein Family
UniProt Gene Name
DLL4
UniProt Synonym Gene Names
Delta4
NCBI Description
This gene is a homolog of the Drosophila delta gene. The delta gene family encodes Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. [provided by RefSeq, Jul 2008]
Uniprot Description
Involved in the Notch signaling pathway as Notch ligand (PubMed:11134954). Activates NOTCH1 and NOTCH4. Involved in angiogenesis; negatively regulates endothelial cell proliferation and migration and angiogenic sprouting (PubMed:20616313). Essential for retinal progenitor proliferation. Required for suppressing rod fates in late retinal progenitors as well as for proper generation of other retinal cell types (). During spinal cord neurogenesis, inhibits V2a interneuron fate (PubMed:17728344).
Research Articles on DLL4
Similar Products
Product Notes
The DLL4 dll4 (Catalog #AAA9139789) is an Active Protein produced from Human Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: SGVFQLQLQE FINERGVLAS GRPCEPGCRT FFRVCLKHFQ AVVSPGPCTF GTVSTPVLGT NSFAVRDDSS GGGRNPLQLP FNFTWPGTFS LIIEAWHAPG DDLRPEALPP DALISKIAIQ GSLAVGQNWL LDEQTSTLTR LRYSYRVICS DNYYGDNCSR LCKKRNDHFG HYVCQPDGNL SCLPGWTGEY CQQPICLSGC HEQNGYCSKP AECLCRPGWQ GRLCNECIPH NGCRHGTCST PWQCTCDEGW GGLFC. It is sometimes possible for the material contained within the vial of "DLL4, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
