Rabbit anti-Human, Mouse LRP10 Polyclonal Antibody | anti-LRP10 antibody
LRP10 Polyclonal Antibody
Gene Names
LRP10; LRP9; LRP-10; MST087; MSTP087
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
LRP10; Polyclonal Antibody; LRP10 Polyclonal Antibody; LRP9; MST087; MSTP087; anti-LRP10 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAG
Sequence Length
556
Applicable Applications for anti-LRP10 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human LRP10
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Membrane, Single-pass type I membrane protein, coated pit
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Product Categories/Family for anti-LRP10 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
60kDa/76kDa
NCBI Official Full Name
low-density lipoprotein receptor-related protein 10 isoform 2
NCBI Official Synonym Full Names
LDL receptor related protein 10
NCBI Official Symbol
LRP10
NCBI Official Synonym Symbols
LRP9; LRP-10; MST087; MSTP087
NCBI Protein Information
low-density lipoprotein receptor-related protein 10
UniProt Protein Name
Low-density lipoprotein receptor-related protein 10
Protein Family
UniProt Gene Name
LRP10
UniProt Synonym Gene Names
LRP-10
NCBI Description
This gene encodes a low density lipoprotein receptor family protein. A similar protein in mouse is thought to play a role in the uptake of apolipoprotein E-containing lipoproteins. [provided by RefSeq, Jul 2016]
Uniprot Description
Probable receptor, which is involved in the internalization of lipophilic molecules and/or signal transduction. May be involved in the uptake of lipoprotein APOE in liver ().
Research Articles on LRP10
Similar Products
Product Notes
The LRP10 lrp10 (Catalog #AAA9134859) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LRP10 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's LRP10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the LRP10 lrp10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HPDRIIFPNH ACEDPPAVLL EVQGTLQRPL VRDSRTSPAN CTWLILGSKE QTVTIRFQKL HLACGSERLT LRSPLQPLIS LCEAPPSPLQ LPGGNVTITY SYAG. It is sometimes possible for the material contained within the vial of "LRP10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
