Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Mouse, Rat ZNF174 Polyclonal Antibody | anti-ZNF174 antibody

ZNF174 Polyclonal Antibody

Gene Names
ZNF174; ZSCAN8
Reactivity
Mouse, Rat
Applications
Immunohistochemistry
Purity
Affinity Purification
Synonyms
ZNF174; Polyclonal Antibody; ZNF174 Polyclonal Antibody; ZSCAN8; anti-ZNF174 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFRRFCYQEVSGPQEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPKQWVAVCMQGQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSPLLQEPTPKLAGTELLIEKTDPNMATDELPCKLWLSFIA
Sequence Length
234
Applicable Applications for anti-ZNF174 antibody
Immunohistochemistry (IHC)
Application Notes
IHC: 1:50 - 1:200
Immunogen
Recombinant protein of human ZNF174
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-ZNF174 antibody
This gene encodes a protein with three Cys2-His2-type zinc fingers in the carboxy-terminus, a putative nuclear localization signal, and an amino-terminus SCAN box which forms homodimers. This protein is believed to function as a transcriptional repressor. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Product Categories/Family for anti-ZNF174 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa/46kDa
NCBI Official Full Name
zinc finger protein 174 isoform b
NCBI Official Synonym Full Names
zinc finger protein 174
NCBI Official Symbol
ZNF174
NCBI Official Synonym Symbols
ZSCAN8
NCBI Protein Information
zinc finger protein 174
UniProt Protein Name
Zinc finger protein 174
Protein Family
UniProt Gene Name
ZNF174
UniProt Synonym Gene Names
ZSCAN8

NCBI Description

This gene encodes a protein with three Cys2-His2-type zinc fingers in the carboxy-terminus, a putative nuclear localization signal, and an amino-terminus SCAN box which forms homodimers. This protein is believed to function as a transcriptional repressor. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Dec 2016]

Uniprot Description

Transcriptional repressor.

Research Articles on ZNF174

Similar Products

Product Notes

The ZNF174 znf174 (Catalog #AAA9134793) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF174 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF174 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC). IHC: 1:50 - 1:200. Researchers should empirically determine the suitability of the ZNF174 znf174 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAKMEITLS SNTEASSKQE RHIIAKLEEK RGPPLQKNCP DPELCRQSFR RFCYQEVSGP QEALSQLRQL CRQWLQPELH TKEQILELLV MEQFLTILPP EIQARVRHRC PMSSKEIVTL VEDFHRASKK PKQWVAVCMQ GQKVLLEKTG SQLGEQELPD FQPQTPRRDL RESSPAEPSQ AGAYDRLSPH HWEKSPLLQE PTPKLAGTEL LIEKTDPNMA TDELPCKLWL SFIA. It is sometimes possible for the material contained within the vial of "ZNF174, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.