Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of mouse eye, using GUCY2F antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

Rabbit anti-Mouse GUCY2F Polyclonal Antibody | anti-GUCY2F antibody

GUCY2F Polyclonal Antibody

Gene Names
GUCY2F; CYGF; GC-F; GUC2F; GUC2DL; RETGC-2; ROS-GC2
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
GUCY2F; Polyclonal Antibody; GUCY2F Polyclonal Antibody; CYGF; GC-F; GUC2DL; GUC2F; RETGC-2; ROS-GC2; anti-GUCY2F antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
HSALIGGETQMHLLECAHDLKMTDGTYVFVPYDALLYSLPYKHTPYRVLRNNPKLREAYDAVLTITVESQEKTFYQAFTEAAARGEIPEKLEFDQVSPLFGTIYNSIYFIAQAMNNAMKENGQAGAASLVQHSRNMQFHGFNQLMRTDSNGNGISEYVILDTNLKEWELHSTYTVDMEMELLRFGGTPIHFPGGRPPRADAKCWFAEGKIC
Sequence Length
1108
Applicable Applications for anti-GUCY2F antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human GUCY2F
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Membrane, Single-pass type I membrane protein
Positive Samples
Mouse eye
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of mouse eye, using GUCY2F antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of mouse eye, using GUCY2F antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-GUCY2F antibody
The protein encoded by this gene is a guanylyl cyclase found predominantly in photoreceptors in the retina. The encoded protein is thought to be involved in resynthesis of cGMP after light activation of the visual signal transduction cascade, allowing a return to the dark state. This protein is a single-pass type I membrane protein. Defects in this gene may be a cause of X-linked retinitis pigmentosa.
Product Categories/Family for anti-GUCY2F antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 124kDa
Observed: 125kDa
NCBI Official Full Name
retinal guanylyl cyclase 2
NCBI Official Synonym Full Names
guanylate cyclase 2F, retinal
NCBI Official Symbol
GUCY2F
NCBI Official Synonym Symbols
CYGF; GC-F; GUC2F; GUC2DL; RETGC-2; ROS-GC2
NCBI Protein Information
retinal guanylyl cyclase 2
UniProt Protein Name
Retinal guanylyl cyclase 2
Protein Family
UniProt Gene Name
GUCY2F
UniProt Synonym Gene Names
GUC2F; RETGC2; RETGC-2; GC-F; ROS-GC2

NCBI Description

The protein encoded by this gene is a guanylyl cyclase found predominantly in photoreceptors in the retina. The encoded protein is thought to be involved in resynthesis of cGMP after light activation of the visual signal transduction cascade, allowing a return to the dark state. This protein is a single-pass type I membrane protein. Defects in this gene may be a cause of X-linked retinitis pigmentosa. [provided by RefSeq, Dec 2008]

Uniprot Description

Probably plays a specific functional role in the rods and/or cones of photoreceptors. It may be the enzyme involved in the resynthesis of cGMP required for recovery of the dark state after phototransduction.

Research Articles on GUCY2F

Similar Products

Product Notes

The GUCY2F gucy2f (Catalog #AAA9134248) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GUCY2F Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's GUCY2F can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the GUCY2F gucy2f for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HSALIGGETQ MHLLECAHDL KMTDGTYVFV PYDALLYSLP YKHTPYRVLR NNPKLREAYD AVLTITVESQ EKTFYQAFTE AAARGEIPEK LEFDQVSPLF GTIYNSIYFI AQAMNNAMKE NGQAGAASLV QHSRNMQFHG FNQLMRTDSN GNGISEYVIL DTNLKEWELH STYTVDMEME LLRFGGTPIH FPGGRPPRAD AKCWFAEGKI C. It is sometimes possible for the material contained within the vial of "GUCY2F, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.