Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using PNP antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.)
Rabbit anti-Human, Mouse PNP Polyclonal Antibody | anti-PNP antibody
PNP Polyclonal Antibody
Gene Names
PNP; NP; PUNP; PRO1837
Reactivity
Human, Mouse
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purification
Synonyms
PNP; Polyclonal Antibody; PNP Polyclonal Antibody; NP; PRO1837; PUNP; anti-PNP antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKA
Sequence Length
289
Applicable Applications for anti-PNP antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
WB: 1:500 - 1:2000
IF: 1:50 - 1:200
IF: 1:50 - 1:200
Immunogen
Recombinant protein of human PNP
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, cytoskeleton
Positive Samples
H460, Mouse liver
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using PNP antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using PNP antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.)
Related Product Information for anti-PNP antibody
This gene encodes an enzyme which reversibly catalyzes the phosphorolysis of purine nucleosides. The enzyme is trimeric, containing three identical subunits. Mutations which result in nucleoside phosphorylase deficiency result in defective T-cell (cell-mediated) immunity but can also affect B-cell immunity and antibody responses. Neurologic disorders may also be apparent in patients with immune defects. A known polymorphism at aa position 51 that does not affect enzyme activity has been described. A pseudogene has been identified on chromosome 2.
Product Categories/Family for anti-PNP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 32kDa
Observed: 30kDa; 35kDa
Observed: 30kDa; 35kDa
NCBI Official Full Name
purine nucleoside phosphorylase
NCBI Official Synonym Full Names
purine nucleoside phosphorylase
NCBI Official Symbol
PNP
NCBI Official Synonym Symbols
NP; PUNP; PRO1837
NCBI Protein Information
purine nucleoside phosphorylase
UniProt Protein Name
Purine nucleoside phosphorylase
Protein Family
UniProt Gene Name
PNP
UniProt Synonym Gene Names
NP; PNP
NCBI Description
This gene encodes an enzyme which reversibly catalyzes the phosphorolysis of purine nucleosides. The enzyme is trimeric, containing three identical subunits. Mutations which result in nucleoside phosphorylase deficiency result in defective T-cell (cell-mediated) immunity but can also affect B-cell immunity and antibody responses. Neurologic disorders may also be apparent in patients with immune defects. A known polymorphism at aa position 51 that does not affect enzyme activity has been described. A pseudogene has been identified on chromosome 2. [provided by RefSeq, Jul 2008]
Uniprot Description
The purine nucleoside phosphorylases catalyze the phosphorolytic breakdown of the N-glycosidic bond in the beta-(deoxy)ribonucleoside molecules, with the formation of the corresponding free purine bases and pentose-1-phosphate.
Research Articles on PNP
Similar Products
Product Notes
The PNP pnp (Catalog #AAA9134042) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PNP Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PNP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). WB: 1:500 - 1:2000 IF: 1:50 - 1:200. Researchers should empirically determine the suitability of the PNP pnp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MENGYTYEDY KNTAEWLLSH TKHRPQVAII CGSGLGGLTD KLTQAQIFDY GEIPNFPRST VPGHAGRLVF GFLNGRACVM MQGRFHMYEG YPLWKVTFPV RVFHLLGVDT LVVTNAAGGL NPKFEVGDIM LIRDHINLPG FSGQNPLRGP NDERFGDRFP AMSDAYDRTM RQRALSTWKQ MGEQRELQEG TYVMVAGPSF ETVAECRVLQ KLGADAVGMS TVPEVIVARH CGLRVFGFSL ITNKVIMDYE SLEKA. It is sometimes possible for the material contained within the vial of "PNP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
